Recombinant Haemophilus influenzae UPF0761 membrane protein NTHI0384 (NTHI0384)

Shipped with Ice Packs
In Stock

Description

Research Applications

NTHI0384 is primarily used in in vitro studies to:

  1. Study Bacterial Pathogenesis: Investigate its role in colonization, immune evasion, or disease progression .

  2. Develop Therapeutic Targets: Screen for inhibitors or vaccines targeting NTHi membrane proteins .

  3. Membrane Protein Biochemistry: Analyze lipid-protein interactions or structural dynamics using techniques like native mass spectrometry .

Example Experimental Workflow

  1. Purification: Affinity chromatography (His-tag) followed by lyophilization .

  2. Functional Assays:

    • Adhesion: Co-incubate with epithelial cells or ECM components (e.g., fibronectin) .

    • Membrane Stability: Assess osmotic sensitivity or vesiculation .

  3. Structural Analysis: Cryo-EM or X-ray crystallography to resolve 3D conformation .

Genomic and Population Context

NTHi strains exhibit clonal population structures linked to virulence factors and lipooligosaccharide (LOS) biosynthesis . While NTHI0384 is not explicitly tied to LOS or adhesin genes (e.g., hap, hia/hsf), its presence may correlate with specific clades or disease phenotypes.

CladeAssociated Virulence FactorsNTHI0384 Status
VIhia/hsf, hif Not reported
II–IVhmw1/ hmw2, igaB Not reported
Vlpt3, altered LOS structure Not reported

Challenges and Future Directions

  • Structural Elucidation: High-resolution structural data are lacking due to challenges in crystallizing membrane proteins .

  • Functional Validation: Direct evidence of NTHI0384’s role in infection or colonization remains absent.

  • Therapeutic Potential: Requires screening for interactions with host receptors or immune components.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please specify this during order placement, and we will prioritize its development.
Synonyms
NTHI0384; UPF0761 membrane protein NTHI0384
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Haemophilus influenzae (strain 86-028NP)
Target Names
NTHI0384
Target Protein Sequence
MISLKNFGLLFWKRFSENKLNQVAGALTYSTMLAIVPLVMVIFSIFSAFPVFNEVTGELK EMIFTNFAPSASDMVGEYIDQFVSNSKKMSAVGIVSLIAVALMLINNIDRTLNSIWHNSQ SRSPLSSFAIYWMILTLGPLIIGVSIGISSYIKIMFEQSEHLSLGLKLLSFVPFLFTWFI FTLIYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAFTWYVVTFPSYQLIYGAMATLPIML LWIQISWLVVLVGAQLASTLDEIGEQIEQ
Uniprot No.

Target Background

Database Links

KEGG: hit:NTHI0384

Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of UPF0761 membrane protein NTHI0384?

UPF0761 membrane protein NTHI0384 belongs to the class of outer membrane proteins in nontypeable Haemophilus influenzae. While specific structural data on NTHI0384 is limited, methodological approaches for structural characterization would involve techniques similar to those used for other NTHI membrane proteins. Researchers typically employ X-ray crystallography or cryo-electron microscopy for three-dimensional structure determination. For preliminary characterization, circular dichroism spectroscopy can provide insights into secondary structure elements (α-helices, β-sheets). Similar to TbpB, which has been studied as a vaccine candidate, NTHI0384 likely contains surface-exposed domains that may be immunologically relevant . Initial characterization would involve expression and purification, followed by biochemical analyses to determine membrane topology and potential functional domains.

How is recombinant NTHI0384 protein expressed and purified for research purposes?

Expression of recombinant NTHI0384 would typically follow protocols established for other NTHI membrane proteins. Based on methodologies used for proteins like TbpB, the standard approach involves:

  • Gene cloning into an appropriate expression vector (such as pBJG1 or similar plasmids)

  • Transformation into an expression host (commonly E. coli JM107 or similar strains)

  • Induction of protein expression using IPTG or alternative inducers

  • Cell lysis and membrane fraction isolation

  • Solubilization using appropriate detergents

  • Purification via affinity chromatography (commonly using His-tag technology)

Key considerations include addressing expression challenges such as protein hydrophobicity, codon usage optimization, and potential toxicity to the expression host. For membrane proteins, it's critical to optimize solubilization conditions to maintain native conformation while achieving sufficient yield . Additionally, fusion tags at both termini can help distinguish full-length proteins from truncated products, especially when increasing imidazole concentration during purification .

What is known about the immunological properties of NTHI0384?

While specific immunological data on NTHI0384 is not well-documented, methodological approaches to study its immunological properties would parallel those used for other NTHI membrane proteins. Based on studies with TbpB, researchers would typically:

  • Generate antibodies against purified recombinant NTHI0384

  • Assess antibody binding via Western blot, ELISA, and surface-binding assays

  • Evaluate cross-reactivity against heterologous NTHI strains

  • Test functional antibody properties (bactericidal activity, opsonization)

What are the optimal expression systems for producing conformationally correct NTHI0384?

The selection of expression systems for NTHI0384 requires careful consideration of factors influencing membrane protein folding and insertion. Advanced methodological approaches include:

  • Prokaryotic expression systems:

    • E. coli-based systems with specialized strains (C41/C43, Lemo21)

    • Cold-shock induction strategies to slow folding and prevent aggregation

    • Co-expression with chaperones to enhance proper folding

  • Eukaryotic expression systems:

    • Insect cell/baculovirus systems for complex membrane proteins

    • Mammalian cell expression for proteins requiring specific post-translational modifications

    • Cell-free expression systems with added membranes or nanodiscs

  • Expression optimization parameters:

    • Temperature modulation (typically 16-25°C for membrane proteins)

    • Induction protocol optimization (concentration, timing, duration)

    • Media composition adjustments (osmolytes, membrane-supporting components)

When comparing expression systems, researchers should evaluate yield, purity, and conformational integrity. For vaccine research applications similar to studies on TbpB, conformational epitope preservation is particularly critical, as antibodies recognizing surface-exposed conformational epitopes are likely key mediators in bacterial clearance .

How can researchers assess the antigenicity and immunogenicity of NTHI0384 for vaccine development?

Evaluating NTHI0384 as a potential vaccine candidate would require comprehensive antigenicity and immunogenicity assessment methodologies:

Table 1: Methodological Approaches for NTHI0384 Vaccine Potential Assessment

Assessment CategoryMethodologyKey ParametersExpected Outcomes
Epitope MappingPeptide arrays, HDX-MS, Cryo-EMSurface-exposed domains, Conformational epitopesIdentification of immunodominant regions
Animal ImmunizationRat/mouse models with adjuvantsDose-response (20-40 μg), Adjuvant selectionAntibody titer, Isotype distribution
Protection EvaluationPulmonary clearance assayBacterial load reduction in BAL fluid and lung homogenates30-60% reduction in viable bacteria
Cross-ProtectionHeterologous challengeRecognition of TbpB from multiple NTHI strainsVariable cross-recognition pattern
Functional Antibody TestsBactericidal assays, Transferrin binding inhibitionAntibody-mediated killing, Receptor blockingStrain-specific efficacy profiles

Drawing from TbpB research, a particular challenge would be assessing cross-protection against heterologous NTHI strains. While antibodies may show binding to multiple strains on Western blots, functional assays often reveal strain-specific efficacy. For instance, TbpB-specific antibodies showed variable ability to block transferrin binding to heterologous strains and demonstrated differential bactericidal activity across strains . This variability suggests that while NTHI0384 might confer protection against homologous strains, cross-protection may be limited by antigenic heterogeneity.

What genetic engineering approaches enable structure-function studies of NTHI0384?

Advanced genetic manipulation techniques can facilitate detailed structure-function analysis of membrane proteins like NTHI0384:

  • Site-directed mutagenesis strategies:

    • Alanine scanning to identify functional residues

    • Cysteine substitution for accessibility studies and cross-linking

    • Conservative versus non-conservative substitutions to probe specific interactions

  • Domain swapping and chimeric constructs:

    • Exchange of domains between heterologous NTHI strains

    • Creation of chimeras with well-characterized membrane proteins

    • Truncation mutants to isolate functional domains

  • In vivo genetic manipulation:

    • Marker exchange methodology using kanamycin resistance cassettes

    • Transformation of circular plasmids incapable of replication in H. influenzae

    • Selection on appropriate antibiotic-containing media (e.g., 65 μg/ml kanamycin)

  • Validation techniques:

    • Dot blot screening with monoclonal antibodies

    • Western blot analysis for protein expression

    • Functional assays specific to predicted protein function

The marker exchange methodology described for H. influenzae involves transforming a Kmr construct (e.g., pBJG1-A) into kanamycin-sensitive NTHI strains, followed by selection on antibiotic-containing media and screening with appropriate antibodies . This approach enables targeted genetic manipulation for studying protein function in its native context.

What are the common challenges in producing soluble recombinant NTHI0384 and how can they be addressed?

Membrane proteins present specific challenges in recombinant expression and solubilization. For NTHI0384, researchers should anticipate and address:

  • Expression challenges:

    • Protein hydrophobicity affecting expression levels

    • Codon usage optimization for the expression host

    • Potential toxicity to expression systems

  • Solubilization strategies:

    • Detergent screening (mild non-ionic detergents often preferred)

    • Amphipol or nanodisc incorporation for native-like environment

    • Fusion with solubility-enhancing tags (MBP, SUMO, thioredoxin)

  • Truncation product management:

    • Dual-tagging strategies (N- and C-terminal tags)

    • Optimized translation initiation sequences

    • Protease inhibitor cocktails during purification

  • Quality control measures:

    • Size exclusion chromatography to assess aggregation state

    • Thermal stability assays to evaluate proper folding

    • Functional assays to confirm bioactive conformation

As observed with other membrane proteins, increasing imidazole concentration during purification and using expression vectors with fusion tags on both termini can help distinguish full-length proteins from truncated products . Additionally, careful analysis of protein sequence and secondary structure can guide optimization of expression conditions to overcome hydrophobicity and codon rarity issues.

How can researchers interpret contradictory data on NTHI0384 cross-reactivity across different NTHI strains?

When analyzing cross-reactivity data for membrane proteins like NTHI0384, researchers often encounter seemingly contradictory results across different assay formats. Based on experience with TbpB, a methodological approach to resolving such contradictions includes:

  • Reconciliation of binding versus functional assays:

    • Western blot results may show cross-reactivity while functional assays reveal strain specificity

    • Antibodies may recognize linear epitopes on denatured proteins but fail to bind native conformations

    • Different assay sensitivities may lead to apparent contradictions

  • Analysis framework for cross-reactivity data:

    • Distinguish surface-exposed versus buried epitopes

    • Separate recognition of linear versus conformational epitopes

    • Correlate antibody binding with functional outcomes (bactericidal activity)

  • Validation approaches:

    • Flow cytometry to assess binding to intact bacteria

    • Competitive inhibition assays to probe epitope specificity

    • Absorption studies to deplete antibodies recognizing specific epitopes

The experience with TbpB demonstrates this phenomenon clearly: while antibodies from rats immunized with rTbpB recognized TbpB from six heterologous NTHI strains on Western blots, these same antibodies showed variable ability to block transferrin binding and variable bactericidal activity against different strains . This suggests that recognition of denatured protein on Western blots does not necessarily predict functional activity against conformational epitopes on the bacterial surface.

What AI-powered approaches can accelerate research on poorly characterized proteins like NTHI0384?

Modern computational and AI methods offer powerful tools to accelerate research on novel proteins:

  • Structure prediction approaches:

    • AlphaFold2 and RoseTTAFold for ab initio structure prediction

    • Molecular dynamics simulations to assess membrane interactions

    • Epitope prediction algorithms to identify potential antigenic regions

  • Data mining and analysis:

    • Global search across research repositories for related proteins

    • AI-powered affinity mapping for literature connections

    • Natural language processing to extract methodological insights from publications

  • Experimental design optimization:

    • AI-suggested tags for efficient data structure organization

    • Automated summaries of research evidence to identify key takeaways

    • Collaborative analysis tools for synthesizing disparate data sources

These computational approaches allow researchers to rapidly generate hypotheses about protein function and structure that can guide experimental design. AI-powered tools enable efficient analysis of complex datasets, helping researchers uncover patterns across disparate studies and standardize taxonomy for consistent data interpretation .

How does NTHI0384 compare to other NTHI membrane proteins as a potential vaccine candidate?

When evaluating NTHI0384 alongside other NTHI membrane proteins for vaccine development, researchers should consider multiple parameters:

Table 2: Comparative Analysis of NTHI Membrane Proteins as Vaccine Candidates

ParameterNTHI0384 (UPF0761)TbpBP1 Outer Membrane Protein
Conservation Across StrainsRequires assessmentVariable with heterogeneity in surface-exposed domainsContains conserved epitopes
ImmunogenicityRequires assessmentDemonstrated in rat modelsDemonstrated in multiple models
Protection EfficacyUnknown34-58% reduction in BAL fluid; 26-60% in lung homogenatesHigher reported clearance than TbpB
Cross-ProtectionUnknownLimited due to variable recognition of heterologous strainsBetter cross-protection potential
Functional RolePutative membrane proteinHuman transferrin receptor componentMajor outer membrane protein
Adjuvant RequirementsUnknownStandard adjuvants effectiveStandard adjuvants effective

Based on research with TbpB and P6/OMP26 proteins, the efficacy of NTHI0384 would need evaluation through pulmonary clearance assays in animal models. TbpB immunization showed significant but somewhat limited protection (34-58% reduction in bacterial loads), which was lower than that observed with P6 and OMP26 proteins . This comparison highlights the importance of assessing both absolute protection levels and cross-protection potential when evaluating new vaccine candidates.

What ethical considerations should researchers address when designing animal studies to evaluate NTHI0384 immunogenicity?

When designing animal studies for NTHI0384 vaccine development, researchers must address several ethical considerations:

  • Experimental design optimization:

    • Implementation of the 3Rs principle (Replacement, Reduction, Refinement)

    • Statistical power calculations to determine minimum required animal numbers

    • Consideration of alternative in vitro methods where applicable

  • Selection of appropriate animal models:

    • Relevance of the rat pulmonary clearance model for NTHI infection

    • Potential species differences in immune response to NTHI antigens

    • Humanized mouse models for better translational relevance

  • Endpoint selection and humane considerations:

    • Clear definition of humane endpoints to minimize suffering

    • Non-invasive monitoring technologies where possible

    • Appropriate anesthesia and analgesia protocols

  • Translational value assessment:

    • Clear pathway from animal studies to human applications

    • Correlation of animal immune responses with human protection

    • Consideration of natural infection dynamics versus challenge models

Based on protocols used for TbpB research, measurement of pulmonary clearance 4 hours after live bacterial challenge provides a meaningful endpoint while minimizing animal suffering . Additionally, dose-finding studies (comparing 20μg versus 40μg doses) should be designed to identify minimum effective doses that can reduce animal use in subsequent studies .

How might systems biology approaches enhance understanding of NTHI0384 in the context of host-pathogen interactions?

Systems biology offers comprehensive frameworks for understanding membrane proteins within their biological context:

  • Multi-omics integration approaches:

    • Transcriptomics to identify co-regulated genes during infection

    • Proteomics to map protein-protein interaction networks

    • Metabolomics to assess metabolic impact of protein function

  • Host-pathogen interaction mapping:

    • Identification of host receptors or binding partners

    • Temporal dynamics of protein expression during infection

    • Contribution to biofilm formation and persistence

  • Computational modeling:

    • Agent-based models of host-pathogen interactions

    • Prediction of evolutionary constraints on protein sequence

    • In silico screening of potential inhibitors or modulators

Systems biology approaches could help position NTHI0384 within the broader context of NTHI pathogenesis, potentially revealing unexpected functions or interaction partners. This holistic understanding could identify synergistic effects with other membrane proteins, informing combination vaccine strategies or novel therapeutic approaches.

What emerging technologies might accelerate characterization of NTHI0384 and similar membrane proteins?

Several cutting-edge technologies offer promising approaches for membrane protein research:

  • Advanced structural biology methods:

    • Micro-electron diffraction for small crystals

    • Integrative structural biology combining multiple data sources

    • Single-particle cryo-EM for membrane protein complexes

  • High-throughput functional screening:

    • CRISPR-based functional genomics screens

    • Deep mutational scanning for comprehensive structure-function mapping

    • Machine learning-guided directed evolution

  • Single-cell technologies:

    • Single-cell proteomics for heterogeneity assessment

    • Spatial transcriptomics for in situ expression analysis

    • Live-cell imaging with tagged membrane proteins

  • Novel vaccination platforms:

    • mRNA-based expression of membrane antigens

    • Outer membrane vesicle (OMV) display systems

    • Self-assembling nanoparticle presentation of membrane proteins

These emerging technologies could substantially accelerate characterization of poorly understood proteins like NTHI0384, potentially revealing novel functions and therapeutic applications beyond current understanding of NTHI membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.