Recombinant Haemophilus parasuis serovar 5 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Haemophilus parasuis serovar 5 electron transport complex protein RnfE (rnfE) is a bacterially expressed protein derived from the Rnf operon, which plays a critical role in energy metabolism and redox balancing in H. parasuis. This protein has garnered attention for its potential applications in vaccine development, pathogenicity studies, and molecular diagnostics for Glässer’s disease, a swine infection caused by H. parasuis .

Role in Bacterial Metabolism

The Rnf complex (RnfABCDGE) in H. parasuis is integral to electron transport, coupling NADH oxidation with ion translocation across the membrane. RnfE, a subunit of this complex, facilitates energy conservation through redox reactions, which are critical for bacterial survival under anaerobic conditions .

Antigenic Potential

While RnfE is not directly linked to outer membrane virulence factors like P2 or P5 , its conservation across H. parasuis strains suggests potential as a diagnostic marker. Unlike hypervariable surface proteins (e.g., P2 with 25 sequence variants), RnfE exhibits minimal structural heterogeneity, making it a stable candidate for serological assays .

Vaccine Development

Though not yet tested in vaccine trials, RnfE’s role in essential metabolic pathways positions it as a novel target for subunit vaccines. Comparative studies highlight that multi-component vaccines combining outer membrane proteins (e.g., TolC, LppC) and conserved metabolic enzymes like RnfE could enhance cross-protection against diverse H. parasuis serovars .

Pathogenicity Studies

Genome-wide association studies (GWAS) of H. parasuis have identified accessory genome elements, including Rnf operon genes, that correlate with clinical isolates. RnfE’s involvement in iron-sulfur cluster biosynthesis may influence bacterial virulence under host iron-limited conditions .

Production and Availability

Recombinant RnfE is commercially produced via E. coli expression systems, ensuring high yield (>0.1 mg/mL post-reconstitution) and scalability. Key suppliers include:

  • Creative BioMart: Catalog No. RFL1540HF, provided as lyophilized powder .

  • Cusabio: Catalog No. CSB-BP489927HTD1, available in partial-length constructs .

Future Directions

Further studies are needed to:

  1. Characterize RnfE’s immunogenicity in swine models.

  2. Explore its synergy with other antigens (e.g., TolC, LppC) in multi-epitope vaccines .

  3. Validate its role in iron acquisition and oxidative stress response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional charges apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please inform us, and we will prioritize its development.
Synonyms
rnfE; HAPS_1669; Ion-translocating oxidoreductase complex subunit E; Rnf electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Haemophilus parasuis serovar 5 (strain SH0165)
Target Names
rnfE
Target Protein Sequence
MQETQIPITQIDETPKAVEPSVWKNLFTQGVWTNNSTLVQLLGLCPLLAVSNNVTNALGL GLATLLVLTITNTIISLFRKVIPHDIRIPIYVMIIATAVTTIQLLMNAFAFPVYQSLGIF VPLIVTNCIVIGRAEAFASKNSVAHSAFDGFAMGLGMTLSLVVLGAIREIIGNGTLFDGL DLLLGSWAKALRMDLLHLDSGLLLAILPPGAFIGLGLILAVKNIIDRKK
Uniprot No.

Target Background

Function
A component of a membrane-bound complex that facilitates coupling of electron transfer with ion translocation across the membrane.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus parasuis serovar 5 Electron transport complex protein RnfE and what is its significance in research?

Haemophilus parasuis serovar 5 Electron transport complex protein RnfE (rnfE) is a membrane-associated protein that functions as part of the Rnf electron transport complex in Haemophilus parasuis serovar 5. The protein consists of 229 amino acids and plays a critical role in ion-translocating oxidoreductase activity . Its significance in research stems from its involvement in cellular energy metabolism and potential contribution to bacterial pathogenicity. The protein is particularly important for understanding electron transport mechanisms in gram-negative bacteria, which may inform therapeutic targets for treating infections caused by Haemophilus parasuis, a pathogen responsible for Glässer's disease in swine. The recombinant form allows researchers to study the protein's structure-function relationships outside its native environment, enabling more controlled experimental conditions.

What are the optimal storage conditions for maintaining recombinant rnfE protein stability?

Maintaining optimal stability of recombinant rnfE protein requires specific storage conditions that preserve its structural integrity and functional activity. The recommended storage protocol is:

  • Store the lyophilized powder at -20°C/-80°C upon receipt .

  • After reconstitution, aliquot the protein to minimize freeze-thaw cycles, as repeated freezing and thawing significantly reduces protein activity and stability .

  • For short-term storage (up to one week), working aliquots can be maintained at 4°C .

  • For long-term storage, add glycerol to a final concentration of 50% before storing at -20°C/-80°C .

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use .

This storage approach is designed to minimize protein denaturation and maintain the integrity of the tertiary structure essential for functional studies. Researchers should always centrifuge the vial briefly before opening to bring contents to the bottom, particularly when working with lyophilized preparations.

What experimental approaches can be used to study rnfE protein structure-function relationships?

Studying rnfE protein structure-function relationships requires a multi-faceted experimental approach that addresses both structural and functional aspects:

  • Structural Analysis Techniques:

    • X-ray crystallography to determine the 3D structure, focusing on transmembrane domains and binding sites

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements and protein folding

    • NMR spectroscopy for dynamic structural information in solution

    • Cryo-electron microscopy for visualization of the protein within the membrane environment

  • Functional Analysis Methods:

    • Site-directed mutagenesis to modify key amino acid residues and assess their impact on function

    • Electron transport assays using artificial electron donors/acceptors to measure activity

    • Membrane potential measurements to evaluate ion translocation efficiency

    • Protein-protein interaction studies to identify binding partners within the Rnf complex

  • Integrated Approaches:

    • Molecular dynamics simulations combining structural data with functional hypotheses

    • Isothermal titration calorimetry (ITC) to measure binding affinity with potential substrates

    • Reconstitution of recombinant rnfE into proteoliposomes to assess function in a controlled membrane environment

How can researchers verify the integrity and functionality of expressed recombinant rnfE protein?

Verifying both the integrity and functionality of expressed recombinant rnfE protein is critical for ensuring reliable experimental results. A comprehensive validation approach includes:

  • Structural Integrity Assessment:

    • SDS-PAGE analysis to confirm correct molecular weight (the full-length rnfE is 229 amino acids plus any fusion tags)

    • Western blotting using anti-His antibodies (for His-tagged versions) or specific anti-rnfE antibodies

    • Mass spectrometry to verify the complete amino acid sequence and post-translational modifications

    • Circular dichroism to confirm proper protein folding and secondary structure elements

  • Functional Validation:

    • Electron transport activity assays using artificial electron donors and acceptors

    • Membrane insertion assays to confirm proper localization to membrane fractions

    • Binding assays with known interaction partners in the Rnf complex

    • Ion translocation assays using fluorescent probes to measure membrane potential changes

  • Purity Verification:

    • Analytical size exclusion chromatography to assess homogeneity

    • Dynamic light scattering to evaluate aggregation state

    • Purity should exceed 90% as determined by SDS-PAGE for most functional studies

  • Stability Testing:

    • Thermal shift assays to determine protein stability under different buffer conditions

    • Activity measurements after various storage durations to establish functional half-life

When working with membrane proteins like rnfE, particular attention should be paid to proper solubilization and maintenance of the native-like membrane environment to preserve functionality. Detergent selection is critical, as is consideration of lipid composition when reconstituting the protein for functional studies.

What experimental designs are most appropriate for studying rnfE interactions with other components of the electron transport complex?

Studying rnfE interactions with other components of the electron transport complex requires careful experimental design that addresses the challenges of membrane protein complexes. The most appropriate experimental designs include:

  • Co-immunoprecipitation Studies:

    • Design: Express rnfE with affinity tags (His-tag) along with potential partner proteins

    • Controls: Include non-interacting membrane proteins as negative controls

    • Analysis: Mass spectrometry identification of co-precipitated proteins

    • Advantage: Can identify native interaction partners from cellular extracts

  • Cross-linking Coupled with Mass Spectrometry:

    • Design: Use chemical cross-linkers of varying lengths to capture transient interactions

    • Method: Apply cross-linkers to purified rnfE or membrane fractions containing the protein

    • Analysis: Identify cross-linked peptides by mass spectrometry

    • Benefit: Provides spatial constraints for molecular modeling of complex arrangements

  • FRET-based Interaction Analysis:

    • Design: Label rnfE and potential interaction partners with fluorescent donor/acceptor pairs

    • Controls: Include non-interacting protein pairs labeled with the same fluorophores

    • Measurements: Monitor energy transfer as indication of proximity

    • Application: Particularly useful for dynamic interaction studies in reconstituted systems

  • Split-Reporter Complementation Assays:

    • Design: Fuse rnfE and potential partners to complementary fragments of reporter proteins

    • Reporters: Split-GFP, split-luciferase, or bacterial two-hybrid systems

    • Analysis: Measure reporter activity as indication of protein-protein interaction

    • Advantage: Can be performed in living cells to capture physiologically relevant interactions

  • Surface Plasmon Resonance (SPR):

    • Design: Immobilize purified rnfE on sensor chips and flow potential partners

    • Measurements: Real-time association and dissociation kinetics

    • Controls: Include non-specific proteins to control for non-specific binding

    • Benefit: Provides quantitative binding parameters (KD, kon, koff)

When designing these experiments, researchers should account for the membrane-embedded nature of rnfE by using appropriate detergents or membrane mimetics to maintain protein structure and function . Factorial experimental designs can help optimize multiple variables simultaneously, enhancing the efficiency of interaction studies.

How can recombination analysis tools be applied to study genetic diversity in rnfE across different Haemophilus parasuis strains?

Recombination analysis tools offer powerful approaches for investigating genetic diversity in rnfE across Haemophilus parasuis strains, revealing evolutionary patterns and functional adaptations. A comprehensive methodology includes:

  • Sequence Acquisition and Alignment:

    • Collect rnfE sequences from multiple H. parasuis strains through whole-genome sequencing or targeted sequencing

    • Perform multiple sequence alignment using progressive alignment algorithms (MUSCLE, MAFFT)

    • Ensure proper quality control by removing poorly aligned regions and checking for sequencing errors

  • Recombination Analysis Implementation:

    • Apply specialized tools like RAT (Recombination Analysis Tool) to detect potential recombination events

    • RAT provides high-throughput detection capability for recombination in aligned sequences of any length

    • Complement with additional methods such as RDP4, GARD, or ClonalFrameML for validation

  • Visualization and Interpretation:

    • Generate graphical representations of potential recombination breakpoints

    • Identify conserved versus variable regions that may correlate with functional domains

    • Compare recombination patterns with selection pressure analyses (dN/dS ratios)

  • Experimental Validation:

    • Design chimeric rnfE proteins based on recombination analysis predictions

    • Test functionality of chimeric proteins to assess the impact of recombination on protein function

    • Correlate recombination patterns with phenotypic differences between strains

The application of RAT is particularly advantageous as it allows for intuitive visualization of recombination events and can process large datasets with minimal user intervention . When analyzing results, researchers should be aware that apparent recombination signals may sometimes represent false positives, which can be addressed through visual inspection of alignment data and confirmation with alternative methods.

What methodological approaches are recommended for conducting mutagenesis studies to identify critical functional domains in rnfE?

Conducting effective mutagenesis studies to identify critical functional domains in rnfE requires systematic approaches that connect sequence alterations to functional outcomes. The recommended methodology includes:

This structured approach allows for systematic identification of critical residues involved in various aspects of rnfE function, including membrane integration, complex assembly, and electron transport activity.

What are the current methodological challenges in studying the role of rnfE in bacterial energy metabolism and how can they be addressed?

Investigating the role of rnfE in bacterial energy metabolism presents several methodological challenges that require innovative solutions. Current challenges and their potential resolutions include:

  • Membrane Protein Solubilization and Stability:

    • Challenge: Maintaining native structure and function during purification

    • Solution: Implement systematic detergent screening protocols using thermal shift assays to identify optimal solubilization conditions

    • Advanced Approach: Utilize styrene maleic acid lipid particles (SMALPs) or nanodiscs to extract proteins with their native lipid environment intact

  • Functional Reconstitution:

    • Challenge: Recreating physiologically relevant conditions for activity assays

    • Solution: Develop proteoliposome systems with defined lipid compositions that mimic native bacterial membranes

    • Measurement: Employ fluorescent probes to monitor membrane potential and ion translocation in real-time

  • Complex Assembly Analysis:

    • Challenge: Understanding how rnfE interacts with other Rnf complex components

    • Solution: Use cryo-electron microscopy of reconstituted complexes, complemented with cross-linking mass spectrometry

    • Validation: Develop split-reporter systems specific for membrane protein interactions in bacterial cells

  • In Vivo Activity Measurement:

    • Challenge: Correlating in vitro findings with physiological function

    • Solution: Develop genetic systems for controlled expression of wild-type and mutant rnfE in native hosts

    • Assessment: Implement metabolic flux analysis to quantify changes in energy production pathways

  • Experimental Design Complexity:

    • Challenge: Multiple interacting variables affecting rnfE function

    • Solution: Apply systematic experimental design approaches such as response surface methodology to efficiently explore multidimensional parameter spaces

    • Analysis: Use multivariate statistical methods to interpret complex datasets

  • Data Integration:

    • Challenge: Connecting structural, biochemical, and physiological data

    • Solution: Develop integrated computational models that incorporate data from multiple experimental approaches

    • Validation: Test model predictions through targeted experiments

  • Technical Reproducibility:

    • Challenge: Ensuring consistent results across different laboratories

    • Solution: Establish standardized protocols for expression, purification, and functional assays

    • Implementation: Create reference standards for activity measurements and quality control metrics

Addressing these challenges requires interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational modeling. By implementing these methodological solutions, researchers can develop a more comprehensive understanding of rnfE's role in bacterial energy metabolism.

What are the recommended protocols for expression and purification of recombinant rnfE protein for structural studies?

Obtaining high-quality recombinant rnfE protein for structural studies requires optimized expression and purification protocols that preserve native structure. The recommended comprehensive protocol includes:

  • Expression System Selection:

    • E. coli-based expression: Use C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • Vector design: Incorporate an N-terminal His-tag for purification with a TEV protease cleavage site

    • Induction conditions: Low temperature induction (16-18°C) with reduced IPTG concentration (0.1-0.5 mM) to favor proper folding

  • Membrane Fraction Isolation:

    • Resuspend cells in lysis buffer (50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, protease inhibitors)

    • Disrupt cells by sonication or high-pressure homogenization

    • Remove cell debris by centrifugation (10,000 g, 20 min, 4°C)

    • Isolate membranes by ultracentrifugation (100,000 g, 1 hour, 4°C)

  • Solubilization and Purification:

    • Solubilize membrane fraction in extraction buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 1% DDM or LMNG)

    • Purify using nickel affinity chromatography with imidazole gradient elution

    • Perform size exclusion chromatography in buffer containing 0.05% DDM or LMNG

    • Optional: Remove His-tag with TEV protease if required for structural studies

  • Quality Control Assessments:

    • Verify purity by SDS-PAGE (target >95% for structural studies)

    • Confirm identity by Western blot and mass spectrometry

    • Assess homogeneity by dynamic light scattering

    • Verify functional integrity through activity assays

  • Storage for Structural Studies:

    • Concentrate to 5-10 mg/mL using 100 kDa MWCO concentrators

    • Add glycerol to 10% final concentration

    • Flash-freeze in liquid nitrogen and store at -80°C in small aliquots

This protocol is designed to maximize yield while maintaining protein quality suitable for structural studies. For crystallography attempts, additional screening for stabilizing conditions may be necessary due to the challenging nature of membrane protein crystallization.

How can researchers design controlled experiments to investigate rnfE function in different host systems?

Designing controlled experiments to investigate rnfE function across different host systems requires careful consideration of variables that may influence protein expression, localization, and activity. A systematic experimental design approach includes:

  • Host System Selection and Preparation:

    • Selection criteria: Choose diverse hosts ranging from E. coli (heterologous expression) to native Haemophilus or related organisms

    • Control strains: Generate knockout strains lacking native rnfE for complementation studies

    • Expression vectors: Design consistent expression cassettes with identical regulatory elements across systems

  • Experimental Design Structure:

    • Implement factorial design to efficiently test multiple variables simultaneously

    • Include the following factors in design:

      • Host genetic background (wild-type vs. rnfE-deficient)

      • rnfE expression level (controlled by promoter strength)

      • Growth conditions (aerobic vs. anaerobic)

      • Carbon source (fermentable vs. non-fermentable)

  • Control Variables for Cross-System Comparison:

    • Standardize growth phase for all analyses (mid-logarithmic)

    • Normalize protein expression levels using calibrated Western blot analysis

    • Account for differences in membrane composition through lipidomic analysis

    • Control for potential compensatory mechanisms through transcriptomic profiling

  • Functional Assessment Protocol:

    • Membrane potential: Measure using potentiometric fluorescent dyes (DiSC3(5))

    • Electron transport: Quantify using oxygen consumption rates or artificial electron acceptors

    • ATP production: Measure cellular ATP levels using luciferase-based assays

    • Growth phenotyping: Conduct high-resolution growth curve analysis under various conditions

  • Data Analysis Framework:

    • Apply analysis of variance (ANOVA) to identify significant effects and interactions

    • Use response surface methodology to model complex relationships between variables

    • Implement multivariate analysis to identify patterns across different host systems

Table 1: Experimental Design Matrix for Cross-Host rnfE Functional Analysis

Host SystemGenetic BackgroundrnfE Expression LevelGrowth ConditionCarbon SourceReplicates
E. coliWild-typeLowAerobicGlucosen=5
E. coliWild-typeLowAnaerobicGlucosen=5
E. coliWild-typeHighAerobicGlucosen=5
E. coliWild-typeHighAnaerobicGlucosen=5
E. colirnfE-deficientLowAerobicGlyceroln=5
E. colirnfE-deficientLowAnaerobicGlyceroln=5
H. parasuisWild-typeNativeAerobicGlucosen=5
H. parasuisWild-typeNativeMicroaerobicGlucosen=5
H. parasuisrnfE-deficientComplementedAerobicGlucosen=5
H. parasuisrnfE-deficientComplementedMicroaerobicGlucosen=5

This structured approach ensures that differences in rnfE function across host systems can be attributed to specific biological factors rather than experimental variables, providing robust cross-system comparisons.

What are the common challenges in recombinant rnfE protein research and how can they be systematically addressed?

Recombinant rnfE protein research presents several technical challenges that can be addressed through systematic troubleshooting approaches. The following table outlines common issues and their solutions:

Table 2: Troubleshooting Guide for Recombinant rnfE Research

ChallengePossible CausesDiagnostic MethodsSolutions
Low expression yieldToxicity to host cellsGrowth curve comparison with controlUse tightly regulated promoters; C41/C43 E. coli strains
Codon biasCodon adaptation index analysisOptimize codons for expression host
Protein instabilityPulse-chase analysisLower expression temperature (16-18°C)
Protein aggregationImproper membrane insertionFractionation analysisCo-express with chaperones; optimize detergent selection
Detergent incompatibilityThermal shift assaysScreen multiple detergent classes (maltoside, glucoside, fos-choline)
Insufficient lipidThin layer chromatographyAdd specific lipids during purification
Poor solubilizationInappropriate detergentSolubilization efficiency testingTest detergent panel (DDM, LMNG, LDAO)
Insufficient detergent concentrationDetergent titrationOptimize detergent:protein ratio
Buffer incompatibilitypH and salt screeningAdjust ionic strength and pH
Loss of activityDenaturation during purificationCircular dichroismMaintain low temperature; add stabilizers
Critical lipid lossMass spectrometry lipid analysisAdd back essential lipids; use SMA extraction
Oxidation of critical residuesMS identification of modificationsAdd reducing agents; handle under nitrogen
Inconsistent assay resultsVariable protein qualitySEC-MALS analysisImplement rigorous quality control metrics
Assay condition variabilityControl chart trackingStandardize buffers and reaction conditions
Batch-to-batch variationReference standard comparisonCreate internal reference standards

Quality control measures should be implemented at each stage of the research process:

  • Expression Quality Control:

    • Western blot analysis to confirm full-length expression

    • Growth rate monitoring to assess toxicity effects

    • Whole-cell activity assays to verify functional expression

  • Purification Quality Control:

    • SDS-PAGE with densitometry to quantify purity (target >90%)

    • Size exclusion chromatography to assess aggregation state

    • Mass spectrometry to confirm sequence integrity and modifications

  • Functional Quality Control:

    • Thermal stability assays to monitor batch consistency

    • Specific activity measurements with standard substrates

    • Internal reference standards for cross-batch comparison

Implementing this systematic approach to troubleshooting and quality control ensures reliable and reproducible results in recombinant rnfE research.

How can researchers validate the structural integrity of purified rnfE protein for functional studies?

Validating the structural integrity of purified rnfE protein is essential for ensuring reliable functional studies. A comprehensive validation approach should include multiple complementary techniques:

  • Biophysical Characterization:

    • Circular Dichroism (CD) Spectroscopy:

      • Measure secondary structure content in far-UV range (190-250 nm)

      • Compare to theoretical predictions based on amino acid sequence

      • Monitor thermal stability through temperature scans (20-90°C)

    • Fluorescence Spectroscopy:

      • Assess tertiary structure through intrinsic tryptophan fluorescence

      • Measure emission spectra (310-400 nm) after excitation at 280 nm

      • Compare native vs. denatured states to establish baselines

    • Dynamic Light Scattering (DLS):

      • Determine size distribution to identify aggregation

      • Monitor sample homogeneity over time

      • Target polydispersity index <0.2 for structural studies

  • Biochemical Validation:

    • Limited Proteolysis:

      • Incubate with proteases (trypsin, chymotrypsin) at controlled ratios

      • Analyze fragmentation patterns by SDS-PAGE and mass spectrometry

      • Compare to theoretical digestion patterns of properly folded protein

    • Thiol Accessibility:

      • Quantify accessible cysteine residues using Ellman's reagent

      • Compare to predicted accessibility based on structural models

      • Monitor changes under different conditions (pH, temperature)

  • Functional Validation:

    • Lipid Binding Assays:

      • Assess interaction with membrane lipids using fluorescent probes

      • Measure binding affinities through isothermal titration calorimetry

      • Verify specific vs. non-specific interactions

    • Electron Transport Activity:

      • Measure redox activity using artificial electron donors/acceptors

      • Compare specific activity to established benchmarks

      • Assess inhibitor sensitivity profiles

  • Structural Stability Monitoring:

    • Thermal Shift Assays:

      • Determine melting temperature (Tm) using fluorescent dyes

      • Monitor stability in different buffer compositions

      • Establish conditions that maximize stability for functional studies

    • Size Exclusion Chromatography:

      • Verify monodispersity and proper oligomeric state

      • Detect subtle aggregation or degradation

      • Monitor stability over time under storage conditions

Table 3: Acceptance Criteria for Structural Validation of Purified rnfE

Validation MethodParameterAcceptance Criteria
SDS-PAGEPurity>90% single band at expected MW
Western BlotImmunoreactivityPositive signal with anti-rnfE or anti-His antibodies
Size ExclusionMonodispersity>90% in single peak at expected elution volume
CD Spectroscopyα-helix content40-50% (consistent with transmembrane regions)
Thermal StabilityMelting temperatureTm >40°C in optimized buffer
Functional AssaySpecific activity>80% of reference standard activity
Mass SpectrometrySequence coverage>85% with confirmation of terminal sequences

By implementing this multi-faceted validation approach, researchers can ensure that functional studies are performed with structurally intact rnfE protein, leading to more reliable and reproducible results.

What are the emerging research directions for understanding rnfE function in bacterial pathogenesis and potential therapeutic applications?

The study of Haemophilus parasuis serovar 5 rnfE protein presents several promising research directions with implications for both fundamental microbiology and therapeutic development. Emerging areas include:

  • Systems Biology Approaches to rnfE Function:

    • Integration of proteomics, metabolomics, and transcriptomics to map the broader impact of rnfE on cellular metabolism

    • Network analysis to identify compensatory mechanisms when rnfE function is compromised

    • Development of computational models predicting bacterial responses to environmental changes based on rnfE activity

  • Structural Biology Frontiers:

    • Application of cryo-electron microscopy to resolve the structure of the entire Rnf complex with rnfE in native membrane environments

    • Time-resolved structural studies to capture conformational changes during electron transport

    • Integration of structural data with molecular dynamics simulations to understand ion translocation mechanisms

  • Immunological Significance:

    • Investigation of rnfE as a potential vaccine antigen against Haemophilus parasuis infections

    • Examination of host immune responses to rnfE during infection

    • Evaluation of conserved epitopes across different Haemophilus strains for broad-spectrum vaccine development

  • Therapeutic Targeting Strategies:

    • Design of small molecule inhibitors specifically targeting rnfE function based on structural insights

    • Development of peptide-based inhibitors targeting critical protein-protein interactions within the Rnf complex

    • Screening of natural product libraries for compounds disrupting rnfE activity

  • Technological Innovations:

    • Development of biosensors incorporating rnfE for environmental monitoring applications

    • Creation of engineered bacteria with modified rnfE for bioenergy production

    • Application of recombination analysis tools to track rnfE evolution across bacterial populations

These emerging directions represent significant opportunities for researchers to advance our understanding of bacterial energy metabolism and develop novel approaches to combat bacterial infections. The interdisciplinary nature of these research directions highlights the importance of collaborative approaches combining expertise in structural biology, genetics, biochemistry, and computational modeling.

How can researchers integrate experimental data on rnfE with computational approaches for more comprehensive functional analysis?

Integrating experimental data on rnfE with computational approaches creates powerful synergies for comprehensive functional analysis. A methodological framework for this integration includes:

  • Structural Prediction and Refinement:

    • Use amino acid sequence data as input for advanced structure prediction tools (AlphaFold, RoseTTAFold)

    • Refine predictions using experimental constraints from cross-linking or spectroscopic data

    • Generate ensembles of structural models to account for conformational flexibility

    • Validate models against experimental data using statistical measures of fit

  • Molecular Dynamics Simulations:

    • Embed predicted rnfE structures in simulated membrane environments

    • Perform long-timescale simulations to observe conformational dynamics

    • Calculate energetics of ion permeation and substrate binding

    • Test hypotheses about mechanism before designing wet-lab experiments

  • Network Analysis and Systems Integration:

    • Construct protein-protein interaction networks incorporating rnfE

    • Integrate transcriptomic data to identify co-regulated genes

    • Apply flux balance analysis to predict metabolic consequences of rnfE perturbation

    • Develop machine learning models to predict phenotypic outcomes from molecular data

  • Evolutionary Analysis and Comparative Genomics:

    • Apply recombination analysis tools to study rnfE sequence evolution

    • Conduct selection pressure analysis to identify functionally important residues

    • Compare rnfE sequences across bacterial species to identify conserved features

    • Reconstruct ancestral sequences to understand evolutionary trajectories

  • Integrated Data Visualization and Analysis:

    • Develop custom pipelines combining experimental and computational data

    • Create interactive visualizations linking structure, function, and evolutionary data

    • Implement statistical frameworks for integrating heterogeneous data types

    • Use dimensionality reduction techniques to identify patterns across multiple datasets

  • Validation Cycle Implementation:

    • Design experimental approaches specifically to test computational predictions

    • Refine computational models based on new experimental data

    • Establish quantitative metrics for assessing model quality and predictive power

    • Implement iterative workflows that alternate between computation and experimentation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.