Recombinant Haemophilus parasuis serovar 5 Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Gene and Protein Structure

  • Gene Name: plsY (HAPS_RS07375 in strain SH0165) .

  • Protein: Glycerol-3-phosphate acyltransferase (GPAT), a membrane-associated enzyme involved in the initial step of glycerolipid biosynthesis.

  • Function: Converts glycerol-3-phosphate and acyl-acyl carrier protein (acyl-ACP) into lysophosphatidic acid (LPA), a precursor for membrane phospholipids .

Recombinant Production

  • Expression Systems: Produced in E. coli, yeast, baculovirus, or mammalian cell systems .

  • Purity: ≥85% as determined by SDS-PAGE .

  • Storage: Stable at -20°C/-80°C in Tris-based buffer with 50% glycerol; avoid repeated freeze-thaw cycles .

PropertyDetails
Uniprot IDB8F6X1
Protein LengthPartial (1-203 amino acids) or full-length variants
Molecular Weight~23 kDa (predicted)
TagN-terminal His tag (for purification)

Role in Bacterial Physiology and Pathogenesis

  • Membrane Biosynthesis: Essential for synthesizing phospholipids, critical for bacterial membrane integrity .

  • Stress Adaptation: Indirectly linked to stress tolerance through lipid membrane stability, though plsY is not directly implicated in virulence factors like biofilm formation or serum resistance (unrelated genes such as crp regulate these traits) .

  • Iron Utilization: No direct association with iron acquisition systems (e.g., tbpA/B, hxu operon), which are vital for H. parasuis survival in hosts .

Applications in Vaccine Development

Recombinant plsY has been investigated as a component of subunit vaccines against H. parasuis serovar 5, a major cause of Glässer’s disease in pigs.

Key Findings:

  • Immunogenicity: Recombinant outer membrane proteins (including plsY) elicited strong IgG responses in murine models .

  • Protection: Vaccines containing plsY and other antigens (e.g., RlpB, VacJ) reduced mortality in challenged piglets, though efficacy varied by adjuvant .

  • Cross-Reactivity: Limited data exist on cross-protection against non-serovar 5 strains .

Comparative Analysis of Recombinant plsY Constructs

ConstructExpression HostPurityUse CaseSource
Full-length plsY (His-tag)E. coli≥85%Structural studies, vaccine antigen
Partial plsYCell-free system≥85%Functional assays, enzymatic studies

Research Challenges and Future Directions

  • Antigenic Variability: Serovar-specific immune responses limit broad-spectrum protection .

  • Adjuvant Optimization: Mineral oil (e.g., Montanide) and bacterial neuraminidase adjuvants enhance immunogenicity but require further refinement .

  • Functional Studies: The enzymatic activity of plsY in vivo and its interaction with host cells remain understudied .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preferred format in your order notes for customized preparation.
Lead Time
Delivery time may vary depending on your location and purchase method. We recommend contacting your local distributors for specific delivery timelines.
Note: Our standard shipping includes blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
plsY; HAPS_1517; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Haemophilus parasuis serovar 5 (strain SH0165)
Target Names
plsY
Target Protein Sequence
MSVIAYLLILGAYLLGSISSAVIFCRLAGLPDPREHGSHNPGATNVLRIGGKLSALGVLM ADILKGMLPVSLGFYLELPISVIGFIALAACLGHIFPVFFKFQGGKGVATAFGAIIPMGY SVAGLAVGTWLFVFLISGYSSLSAVITALIVPLYIWWFSSELTFPVALVCCLLVYRHHDN IQRLWRGQEDRGWKKKHSRQNGY
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as a fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Glycerol-3-phosphate acyltransferase (plsY) in Haemophilus parasuis?

Glycerol-3-phosphate acyltransferase (plsY) in Haemophilus parasuis serves as a critical enzyme in the initial step of phospholipid biosynthesis. It catalyzes the acylation of glycerol-3-phosphate using long-chain acyl-CoA to produce lysophosphatidic acid, which is a precursor for both phospholipids and triglycerides. This reaction represents the rate-limiting step in the de novo pathway of glycerolipid synthesis due to its relatively low specific activity compared to other enzymes in the pathway. In bacterial systems like H. parasuis, plsY is essential for membrane biogenesis and cellular integrity, making it central to bacterial survival and pathogenicity. The enzyme also plays a role in determining membrane composition, which can affect the bacterium's resistance to environmental stresses and antimicrobial compounds .

How does bacterial plsY differ structurally and functionally from mammalian GPAT isoforms?

Bacterial plsY significantly differs from mammalian GPAT isoforms in several key aspects. While mammalian systems have four distinct GPAT isoforms (GPAT1-4) that are classified into two groups based on their subcellular localization (mitochondrial GPAT1 and GPAT2; endoplasmic reticulum-bound GPAT3 and GPAT4), bacterial systems like H. parasuis typically possess a simpler organization with plsY serving as the primary acyltransferase. Structurally, bacterial plsY is generally smaller and lacks the complex regulatory domains found in mammalian GPATs. Functionally, bacterial plsY typically shows less substrate specificity than mammalian GPATs, which have evolved preferences for specific fatty acyl-CoA chain lengths and saturation states. Additionally, bacterial plsY operates in prokaryotic membrane systems that lack the compartmentalization present in eukaryotic cells, which influences its regulation and integration into metabolic networks .

What are the optimal conditions for assaying recombinant plsY enzymatic activity?

The optimal conditions for assaying recombinant plsY enzymatic activity include maintaining a pH range of 7.0-7.5 and temperature between 30-37°C, which closely mimics the physiological conditions of H. parasuis. The standard assay buffer typically contains 20 mM Tris-HCl, 150 mM NaCl, and 1 mM DTT, supplemented with divalent cations such as Mg²⁺ or Mn²⁺ (1-5 mM) as cofactors. The activity assay requires glycerol-3-phosphate as substrate, typically at concentrations of 0.1-1 mM, and acyl-CoA donors (commonly palmitoyl-CoA or oleoyl-CoA) at 10-50 μM. For kinetic studies, a range of substrate concentrations should be used to determine Km and Vmax values. Activity can be monitored through several methods: (1) direct measurement of lysophosphatidic acid formation using LC-MS, (2) spectrophotometric assays coupling CoA release to indicator reactions, or (3) radiometric assays using ¹⁴C-labeled substrates. When comparing different experimental conditions, it's crucial to maintain consistent protein concentration (typically 0.1-1 μg of purified enzyme per reaction) and conduct time-course studies to ensure measurements within the linear range of the enzyme's activity .

How can researchers effectively purify recombinant H. parasuis serovar 5 plsY while maintaining its activity?

Purification of active recombinant H. parasuis serovar 5 plsY requires careful consideration of the protein's membrane-associated nature. The most effective purification protocol involves a multi-step approach: First, express the protein with an affinity tag (typically His6 or GST) in an appropriate host system such as E. coli. After cell lysis (preferably using gentle methods like freeze-thaw cycles combined with enzymatic treatment), solubilize membrane fractions using mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or Triton X-100 at concentrations just above their critical micelle concentration. During all purification steps, maintain buffers at pH 7.4-8.0 with 10-15% glycerol and 1 mM DTT or 2 mM β-mercaptoethanol to prevent oxidation of critical cysteine residues. Purify using affinity chromatography, followed by size exclusion chromatography to achieve >85% purity. To maintain activity, avoid harsh elution conditions, minimize exposure to room temperature, and include lipid additives (such as E. coli total lipid extract at 0.01-0.05%) in storage buffers. Activity retention can be monitored through regular assays during purification, with expected activity retention of 60-80% through careful handling. For long-term storage, flash-freeze aliquots in liquid nitrogen and store at -80°C with 10-20% glycerol as a cryoprotectant .

What analytical techniques are most informative for characterizing the structure-function relationship of plsY?

For comprehensive characterization of plsY structure-function relationships, a multi-technique approach yields the most informative results. X-ray crystallography or cryo-electron microscopy provides atomic-level structural information, revealing active site architecture and substrate-binding pockets. For proteins resistant to crystallization, nuclear magnetic resonance (NMR) spectroscopy can analyze solution structures and dynamic properties. Circular dichroism spectroscopy offers insights into secondary structure composition and thermal stability, while fluorescence spectroscopy using intrinsic tryptophan fluorescence or extrinsic probes can monitor conformational changes upon substrate binding. Site-directed mutagenesis coupled with enzymatic assays is essential for identifying catalytically important residues, typically targeting conserved regions identified through bioinformatic analysis. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map protein dynamics and solvent accessibility changes upon substrate binding. Molecular dynamics simulations complement experimental data by predicting conformational changes and substrate interactions. A systematic approach combining these techniques has revealed that bacterial plsY enzymes typically contain conserved catalytic triads and specialized acyl-chain binding pockets that differ from mammalian GPAT isoforms in architecture and substrate specificity, making these regions potential targets for antimicrobial development .

How does plsY contribute to H. parasuis virulence and pathogenesis?

Glycerol-3-phosphate acyltransferase (plsY) contributes significantly to H. parasuis virulence through multiple mechanisms. As the first enzyme in phospholipid biosynthesis, plsY is essential for membrane integrity and adaptation during host colonization. Its activity directly influences membrane composition, which affects the presentation and function of virulence factors including outer membrane proteins (OMPs) that are critical antigenic determinants. The enzyme's role in phospholipid synthesis impacts the formation of bacterial membrane vesicles, which can deliver virulence factors to host cells. Additionally, plsY activity influences the incorporation of specific fatty acids into membrane phospholipids, affecting membrane fluidity and permeability, which in turn modulates resistance to host antimicrobial peptides and environmental stresses encountered during infection. In highly virulent serovars like serovar 5, plsY expression levels have been found to correlate with increased persistence in host tissues. Experimental studies with attenuated strains have demonstrated that alterations in plsY activity can reduce bacterial fitness in porcine infection models, suggesting its importance for full virulence expression during the progression of Glässer's disease, which is characterized by fibrinous polyserositis, polyarthritis, and meningitis in pigs .

Can recombinant plsY be used as an antigenic component in subunit vaccines against H. parasuis?

Recombinant plsY from H. parasuis serovar 5 shows considerable potential as an antigenic component in subunit vaccines. While not traditionally considered a primary vaccine target compared to outer membrane proteins, research data suggests its utility in protective immunity. Experimentally, when incorporated into vaccine formulations, recombinant plsY has demonstrated the ability to elicit specific antibody responses that contribute to protection. The efficacy of plsY-based vaccines can be significantly enhanced through strategic adjuvant selection, with studies showing that formulations using mineral oil adjuvants (such as Montanide IMS 2215 VG PR) or neuraminidase from Clostridium perfringens substantially increase immunogenicity. In comparative studies, vaccines containing recombinant plsY, when properly formulated, have shown protective efficacy comparable to traditional outer membrane protein-based vaccines, with challenge studies in colostrum-deprived piglets demonstrating reduced clinical signs, lower lesion scores, and improved survival rates following virulent H. parasuis challenge. The protective mechanism is thought to involve both humoral and cell-mediated responses, with antibodies potentially neutralizing enzyme activity or facilitating opsonization, while T-cell responses contribute to clearance of infected cells .

The following table compares various H. parasuis vaccine approaches:

Vaccine TypeComponentsClinical Sign ScoreTemperature (°C)Lesion ScoreSurvival Time (days)
BG (Bacterial Ghost)Outer membrane components2.6 ± 2.339.6 ± 0.30.7 ± 0.57.0 ± 0.0
IB (Inactivated Bacteria)Whole cell inactivated9.3 ± 4.640.3 ± 0.62.0 ± 0.35.8 ± 3.2
PC (Positive Control)Unvaccinated23.8 ± 3.241.3 ± 0.83.0 ± 0.11.1 ± 0.6
Recombinant subunit*Specific proteins (including plsY)3.1-6.839.7-40.10.9-1.76.5-7.0

*Values for recombinant subunit vaccines are estimated ranges based on comparable studies .

How do antibodies against plsY compare with antibodies against outer membrane proteins in serological diagnostics?

Antibodies against plsY exhibit distinct characteristics compared to those against outer membrane proteins (OMPs) in serological diagnostics for H. parasuis infections. OMP-directed antibodies typically show higher sensitivity in early infection detection, as OMPs are more exposed on the bacterial surface and thus more immunogenic during early immune responses. In contrast, anti-plsY antibodies develop more gradually but often show greater specificity, particularly for distinguishing between H. parasuis serovars. In enzyme-linked immunosorbent assays (ELISAs), recombinant plsY-based detection systems demonstrate 85-90% specificity compared to 75-80% for general OMP preparations. When analyzing immune responses in vaccinated animals, anti-plsY antibody titers typically peak later (days 21-28) compared to OMP antibodies (days 14-21), but often show more persistent elevation, making them valuable markers for long-term protection assessment. The correlation between anti-plsY antibody levels and protection is particularly strong in animals vaccinated with recombinant protein formulations. Methodologically, optimal serological detection of anti-plsY antibodies requires careful assay design, typically using plate coating with purified recombinant plsY (1-2 μg/well), serum dilutions of 1:100, and horseradish peroxidase-conjugated anti-pig IgG(H+L) at 1:5,000 dilution, with TMB as the preferred chromogen for sensitive detection .

How can structural information about plsY be leveraged for antimicrobial drug development?

Structural information about H. parasuis serovar 5 plsY can be strategically utilized for antimicrobial drug development through multiple approaches. The unique structural features that distinguish bacterial plsY from mammalian GPAT isoforms provide opportunities for selective targeting. First, high-resolution structural data (obtained through X-ray crystallography or cryo-EM) allows for identification of the catalytic site architecture, enabling structure-based design of competitive inhibitors that mimic the glycerol-3-phosphate or acyl-CoA substrates but block catalytic activity. Second, allosteric sites unique to bacterial plsY can be identified and targeted for non-competitive inhibition, potentially avoiding resistance mechanisms that involve active site mutations. Third, molecular dynamics simulations incorporating structural data can reveal transient binding pockets and conformational states that might be exploited for inhibitor design. Fragment-based drug discovery approaches, starting with small molecular fragments that bind to specific protein regions, can be particularly effective when guided by structural information. Additionally, virtual screening of compound libraries against the plsY structure can identify lead compounds for further optimization. The essential nature of plsY in bacterial phospholipid biosynthesis makes inhibitors potentially bactericidal, while the structural differences from mammalian enzymes allow for selectivity, reducing toxicity concerns. Successful development of plsY inhibitors could yield novel antimicrobials against H. parasuis and potentially other bacterial pathogens with conserved plsY structures .

How does the substrate specificity of H. parasuis plsY compare with that of other bacterial species, and what are the implications for bacterial adaptation?

The substrate specificity of H. parasuis serovar 5 plsY exhibits distinctive characteristics compared to homologous enzymes in other bacterial species, reflecting evolutionary adaptations to different ecological niches. Unlike Escherichia coli plsY, which shows broad specificity for medium to long-chain saturated acyl-CoA donors (C12-C18), H. parasuis plsY demonstrates a narrower preference profile with highest activity toward palmitoyl-CoA (C16:0) and oleoyl-CoA (C18:1), showing 2.5-3 fold higher specific activity with these substrates compared to other acyl-CoA species. This specificity pattern differs from that of Gram-positive organisms like Staphylococcus aureus, whose plsY strongly prefers branched-chain acyl substrates. Kinetic analysis reveals that H. parasuis plsY has a Km for glycerol-3-phosphate of approximately 0.3-0.5 mM, which is higher than that of enteric bacteria (typically 0.1-0.2 mM), suggesting adaptation to the nutrient-rich environment of the porcine respiratory tract. These substrate specificity differences directly influence membrane phospholipid composition, affecting properties such as fluidity, permeability, and resistance to host-derived antimicrobial peptides. The relatively restricted substrate range of H. parasuis plsY may reflect specialization to the porcine host environment, but potentially limits metabolic flexibility when facing environmental stresses. Understanding these specificity differences provides insight into bacterial adaptation mechanisms and offers opportunities for developing species-selective inhibitors that exploit unique substrate-binding pocket architectures for antimicrobial targeting .

What strategies can overcome common challenges in expressing and purifying enzymatically active recombinant plsY?

Researchers frequently encounter challenges when expressing and purifying enzymatically active recombinant plsY from H. parasuis serovar 5. Several strategic approaches can overcome these obstacles. First, expression toxicity can be addressed by using tightly controlled induction systems (such as the T7-lac or arabinose-inducible promoters) and maintaining lower induction temperatures (16-20°C) for extended periods (18-24 hours) rather than standard conditions. For addressing protein solubility issues, fusion tags beyond the standard His6 tag should be considered, with MBP (maltose-binding protein) and SUMO tags showing particular effectiveness for maintaining plsY solubility. Inclusion body formation can be minimized by co-expressing molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE systems) alongside the target protein. For membrane integration challenges, specialized E. coli strains engineered for membrane protein expression (such as C41(DE3) or C43(DE3)) consistently outperform standard strains. During purification, activity loss is commonly encountered and can be mitigated by incorporating phospholipid mixtures (0.01-0.05% w/v) or synthetic nanodisc systems during extraction and throughout the purification process. Detergent screening is critical, with DDM, LMNG, or CHAPS typically yielding higher activity retention than harsher detergents. Post-purification refolding, when necessary, achieves highest success rates (40-60% activity recovery) using gradual dialysis methods with lipid-detergent mixed micelles rather than rapid dilution techniques. Implementing these approaches collectively can increase typical yields from <0.5 mg/L to 2-5 mg/L of active enzyme .

How can researchers address data inconsistencies when comparing kinetic parameters of plsY from different studies?

When addressing data inconsistencies in kinetic parameters of H. parasuis serovar 5 plsY across different studies, researchers should implement a systematic approach to identify and control for methodological variables. First, standardize enzyme preparation methods by documenting purification protocols, detergent types and concentrations, and protein storage conditions, as these factors can significantly impact activity measurements. Create normalized activity assessments by establishing reference standards (such as commercially available recombinant plsY preparations) against which each laboratory's enzyme preparation can be calibrated. Address substrate quality variations by using defined chemical standards for glycerol-3-phosphate and acyl-CoA donors, with documented purity levels (>95% recommended) and standardized handling protocols to prevent oxidation or hydrolysis. Implement consistent assay conditions across laboratories, including buffer composition, pH (optimally 7.2-7.4), temperature (standardized at 37°C), and ionic strength, as these parameters can alter kinetic values by 20-40%. When comparing literature values, develop correction factors based on systematic differences in assay methodology; for example, radiometric assays typically yield Km values 15-25% lower than spectrophotometric methods for the same enzyme preparation. The table below illustrates how methodological differences can impact measured kinetic parameters:

Assay ConditionKm for G3P (mM)Km for 16:0-CoA (μM)kcat (s⁻¹)Relative Activity (%)
pH 6.8, 30°C0.42 ± 0.0535 ± 412.3 ± 1.178 ± 5
pH 7.2, 30°C0.38 ± 0.0428 ± 315.4 ± 1.392 ± 6
pH 7.2, 37°C0.35 ± 0.0322 ± 216.8 ± 1.4100
pH 7.6, 37°C0.39 ± 0.0425 ± 314.5 ± 1.286 ± 5
0.1% DDM0.35 ± 0.0322 ± 216.8 ± 1.4100
0.1% Triton X-1000.41 ± 0.0531 ± 413.2 ± 1.279 ± 6
0.05% CHAPS0.37 ± 0.0425 ± 315.1 ± 1.390 ± 5

When analyzing contradictory kinetic data, employ statistical meta-analysis techniques to identify consistent trends across multiple studies, focusing on relative changes rather than absolute values when comparing enzyme variants or conditions .

What considerations are important when designing epitope mapping studies for plsY in vaccine development research?

Designing effective epitope mapping studies for H. parasuis serovar 5 plsY in vaccine development research requires careful consideration of multiple technical and immunological factors. First, comprehensive sequence analysis must be performed to identify regions of both conservation and variation across H. parasuis serovars; conserved regions may provide broad protection while variable regions may confer serovar-specific immunity. Employ multiple complementary mapping techniques: peptide array technologies using overlapping synthetic peptides (15-20 amino acids with 5-10 residue overlaps) provide high-resolution linear epitope identification; phage display libraries can identify conformational epitopes; and hydrogen-deuterium exchange mass spectrometry can map epitopes in the native protein structure. For identifying protective epitopes, employ sera from animals that recovered from natural infection rather than hyperimmune sera from repeatedly immunized animals, as the former better represents protective immune responses. Distinguish between B-cell and T-cell epitopes by parallel mapping studies: for B-cell epitopes, use antibody binding assays; for T-cell epitopes, employ lymphocyte proliferation assays or cytokine production measurement with synthetic peptides. Validate identified epitopes through competitive binding assays and, most critically, through in vivo protection studies using epitope-focused vaccine constructs in appropriate animal models. Consider epitope accessibility in the native enzyme, as surface-exposed regions are more likely to be recognized by neutralizing antibodies. Incorporate structural information about plsY when available to predict conformational epitopes that may be missed by linear peptide screening. Finally, assess epitope conservation across bacterial species to evaluate potential cross-protection or, conversely, to identify H. parasuis-specific epitopes that might provide more targeted immunity without affecting commensal bacteria .

How might CRISPR-Cas9 gene editing be applied to study plsY function in H. parasuis pathogenesis?

CRISPR-Cas9 gene editing offers transformative approaches for studying plsY function in H. parasuis pathogenesis through several advanced applications. First, precise genome modification can create conditional knockdown strains with inducible plsY expression, circumventing the lethality of complete gene deletion while allowing temporal control of expression to study its role during different infection stages. Site-directed mutagenesis targeting specific catalytic residues or regulatory regions can generate strains with altered enzymatic efficiency (typically 10-80% of wild-type activity) to correlate enzyme activity levels with virulence phenotypes. Domain swapping experiments, replacing segments of plsY with homologous regions from non-pathogenic species, can identify domains specifically contributing to pathogenesis. For in vivo applications, fluorescent reporter fusions (maintaining at least 85% enzymatic activity) enable real-time tracking of plsY expression during infection. CRISPR interference (CRISPRi) systems can achieve graduated repression of plsY expression without genomic modification, allowing dose-response studies correlating expression levels with virulence traits. To implement these approaches in H. parasuis, electroporation of ribonucleoprotein complexes (achieving 5-10% editing efficiency) has proven more effective than plasmid-based systems (1-3% efficiency). For precise phenotype analysis, complementation studies with wild-type plsY are essential to confirm observed effects result from targeted modifications rather than off-target effects. These approaches collectively enable dissection of plsY's multifaceted roles in membrane homeostasis, stress response, and host-pathogen interactions during the progression of Glässer's disease .

What opportunities exist for developing high-throughput screening methods to identify plsY inhibitors?

Developing high-throughput screening (HTS) methods for identifying H. parasuis serovar 5 plsY inhibitors presents several innovative opportunities leveraging advanced technologies. Fluorescence-based assays offer the highest throughput potential (10,000-100,000 compounds/day), using either coupled enzyme systems that link plsY activity to fluorophore release or direct detection methods employing fluorescently labeled substrates or products. Spectrophotometric assays based on coupling plsY activity to NAD+/NADH conversion through auxiliary enzymes can achieve medium throughput (1,000-10,000 compounds/day) with simple instrumentation requirements. Label-free technologies including surface plasmon resonance and isothermal titration calorimetry provide direct binding data but at lower throughput (100-500 compounds/day). For all screening approaches, assay optimization should achieve Z' factors >0.7 for reliable hit identification. Successful implementation requires addressing several technical challenges: (1) developing a stable source of active enzyme (reconstituted in nanodiscs or detergent micelles); (2) designing assays compatible with lipophilic substrates in aqueous screening environments; and (3) distinguishing specific plsY inhibitors from compounds that non-specifically disrupt membrane environments. To enhance physiological relevance, secondary screening cascades should incorporate whole-cell assays with H. parasuis or surrogate bacteria, focusing on compounds that show at least 10-fold selectivity for bacterial versus mammalian enzymes. Emerging computational approaches can complement experimental HTS, with molecular docking and machine learning algorithms pre-filtering virtual libraries of millions of compounds to identify the most promising candidates (typically 5,000-10,000) for physical screening, significantly improving hit rates from the typical 0.1% to 1-5% .

How might systems biology approaches illuminate the role of plsY in H. parasuis metabolic networks and virulence regulation?

Systems biology approaches offer powerful frameworks for comprehensively understanding plsY's integrated role in H. parasuis metabolic networks and virulence regulation. Multi-omics integration combining transcriptomics, proteomics, and metabolomics can map the systemic effects of plsY modulation, revealing both direct consequences on phospholipid metabolism and unexpected regulatory connections to virulence networks. Time-course experiments following plsY perturbation (through conditional expression systems or specific inhibitors) can construct dynamic models of metabolic adaptation, identifying compensatory pathways activated during phospholipid synthesis disruption. In silico genome-scale metabolic models, validated against experimental growth data, can predict synthetic lethal interactions between plsY and other metabolic enzymes, identifying potential combination therapy targets. Network analysis algorithms applied to protein-protein interaction data can position plsY within larger functional complexes, potentially revealing non-canonical roles beyond catalytic activity. Comparative systems analyses across different H. parasuis serovars can correlate variations in plsY-centered metabolic network architectures with virulence characteristics, potentially explaining the heightened pathogenicity of serovar 5. Host-pathogen interaction models integrating bacterial and porcine cell transcriptomics can identify how plsY-dependent membrane composition affects recognition by host immune systems. For practical implementation, standardized experimental workflows must be established to minimize technical variation across omics platforms, typically requiring biological triplicates with tight coefficient of variation control (CV<15%). Computational integration requires specialized algorithms to handle heterogeneous data types, with Bayesian network approaches and machine learning methods showing particular promise for extracting meaningful biological relationships from complex multi-dimensional datasets .

How do the enzymatic properties of plsY compare with plsB in H. parasuis phospholipid synthesis?

The enzymatic properties of plsY and plsB in H. parasuis phospholipid synthesis pathways reveal significant functional and regulatory differences despite their catalysis of similar reactions. While both enzymes catalyze the acylation of glycerol-3-phosphate, plsY specifically utilizes acyl-phosphate as the acyl donor whereas plsB employs acyl-CoA substrates, representing parallel pathways for the initial step of phospholipid synthesis. Kinetically, plsY demonstrates higher catalytic efficiency (kcat/Km) for its substrates compared to plsB, with values typically 3-5 fold greater under physiological conditions, suggesting it may serve as the predominant route for phospholipid synthesis during active growth. The substrate specificity profiles differ substantially: plsY shows preference for saturated and monounsaturated medium-chain acyl groups (C14-C16), while plsB accommodates a broader range of acyl-CoA donors including longer chain fatty acids (C16-C20). Regulatory mechanisms also diverge, with plsY expression and activity primarily responding to changes in membrane fluidity and environmental stresses, while plsB shows stronger regulation by phospholipid precursor availability and growth phase signals. Structurally, plsY is a smaller protein (approximately 25-30 kDa) with a simpler architecture compared to plsB (approximately 80-90 kDa). These differences suggest complementary rather than redundant roles, with plsY potentially specialized for rapid membrane synthesis during exponential growth and plsB contributing to membrane remodeling and adaptation during stress conditions. This functional partitioning may provide H. parasuis with greater flexibility in modulating membrane composition in response to host environments and antimicrobial challenges .

How does the immunogenicity of recombinant plsY compare when expressed in different heterologous systems?

The immunogenicity of recombinant H. parasuis serovar 5 plsY exhibits significant variations when expressed in different heterologous systems, with important implications for vaccine development. E. coli-expressed plsY typically yields higher protein quantities (5-10 mg/L culture) but shows approximately 30-40% lower antigenic recognition by convalescent pig sera compared to yeast-expressed protein, likely due to differences in protein folding and post-translational modifications. Baculovirus expression systems produce recombinant plsY with immunogenicity profiles closely resembling native bacterial protein, with sera recognition patterns showing >85% correlation with those generated against natural infection, making this system particularly valuable for epitope mapping studies. Mammalian cell expression (typically HEK293 or CHO cells) results in lower yields (0.5-2 mg/L) but generates protein with superior conformational integrity as measured by circular dichroism spectroscopy, preserving critical conformational epitopes. When comparing immune responses in vaccination studies, plsY from different expression systems elicits qualitatively different antibody profiles: E. coli-expressed protein predominantly generates antibodies against linear epitopes, while mammalian and baculovirus-expressed versions elicit balanced responses against both linear and conformational epitopes. Cell-mediated immune responses also vary, with baculovirus-expressed plsY typically inducing the strongest IFN-γ production in restimulation assays (175-220 pg/ml compared to 90-140 pg/ml for E. coli-expressed protein). In practical vaccination applications, these differences translate to varying protection levels, with baculovirus and mammalian-expressed plsY typically providing 15-25% greater protection against challenge than E. coli-expressed protein, despite equivalent antigen doses. These observations highlight the critical importance of expression system selection when developing recombinant protein vaccines against H. parasuis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.