Recombinant Haemophilus parasuis serovar 5 Probable intracellular septation protein A (HAPS_0470)

Shipped with Ice Packs
In Stock

Description

Immunological and Vaccine Potential

While HAPS_0470 itself has not been tested in vaccine trials, recombinant outer membrane proteins (OMPs) of H. parasuis show promise:

  • Protective antigens: Recombinant OMPs like GAPDH and HPS-0675 conferred 70% protection in murine models against lethal challenges .

  • Immune response: Subunit vaccines using secreted proteins (e.g., PflA, Ndk) induced robust Th1 responses and opsonophagocytic antibodies in pigs .

HAPS_0470’s structural conservation and membrane association position it as a candidate for similar evaluations, though empirical validation is required .

Applications in Biomedical Research

HAPS_0470 is utilized in:

  • Structural studies: Full-length proteins enable crystallography or NMR to resolve bacterial division mechanisms .

  • Antigen production: Potential use in ELISA or immunoblot assays for diagnosing Glässer’s disease .

  • Vaccine development: As part of multi-component vaccines targeting H. parasuis OMPs .

Challenges and Future Directions

Current limitations include:

  • Functional ambiguity: Lack of direct evidence for HAPS_0470’s role in septation or virulence .

  • Immunogenicity data: No published studies testing its protective efficacy in animal models.

Future research should prioritize:

  • Knockout studies to elucidate its contribution to bacterial survival.

  • Adjuvant-combined trials to assess its vaccine potential .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
yciB; HAPS_0470; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Haemophilus parasuis serovar 5 (strain SH0165)
Target Names
HAPS_0470
Target Protein Sequence
MKQLLEFIPLILFFVVYKTYGVQEAALVLVAATVVQFIALQLLYKKIEKNQWIMGIAVVF FGLLTAYFNDLAFLKWKVTIVNAIFAVALLVSQYVFKKPLIQMLLGKELKLPQNVWEKLN LGWAGFFIFCMIINIIISEFFSDDVWANFKVFGLTGLSLIAVIGTGLYLYPHLKQLEQKE ENNGNTN
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of intracellular septation protein A in H. parasuis serovar 5?

Intracellular septation proteins play critical roles in bacterial cell division and septum formation. Based on characterization of similar proteins in other bacteria, the probable intracellular septation protein A (HAPS_0470) in H. parasuis serovar 5 likely functions in the regulation of cell division processes. Similar proteins, such as ispA in Shigella flexneri, have been shown to affect septum formation, with mutations leading to filamentous bacteria lacking septa . When working with HAPS_0470, researchers should consider its potential involvement in the structural integrity of the bacterial cell and its role in pathogenesis. Experimental approaches should include knockout studies and complementation assays to validate functional predictions.

What expression systems are most effective for producing recombinant H. parasuis outer membrane proteins?

For recombinant expression of H. parasuis proteins, E. coli-based expression systems have demonstrated successful results. The methodology involves cloning the target gene into an appropriate expression vector containing a His-tag sequence for purification purposes. Total genomic DNA should be prepared from H. parasuis serovar 5 strains (e.g., H46), followed by PCR amplification of the target gene. The amplified products should be cloned into expression vectors such as pET-28a(+), and transformed into E. coli BL21(DE3) for protein expression . Induction is typically performed using IPTG (0.2-1.0 mM) when bacterial cultures reach an OD600 of 0.6-0.8, with expression carried out at 16-37°C for 4-16 hours depending on protein characteristics .

How can recombinant H. parasuis proteins be purified efficiently for immunological studies?

Recombinant H. parasuis proteins can be efficiently purified using Ni²⁺-NTA affinity chromatography for His-tagged proteins. The methodology involves:

  • Harvesting bacterial cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspending cell pellets in lysis buffer (typically containing 50 mM NaH₂PO₄, 300 mM NaCl, 10 mM imidazole, pH 8.0)

  • Disrupting cells using sonication (10-15 cycles of 10s on/10s off)

  • Clearing lysates by centrifugation (12,000 × g, 20 min, 4°C)

  • Loading supernatants onto Ni²⁺-NTA columns pre-equilibrated with lysis buffer

  • Washing with wash buffer (typically containing 50 mM NaH₂PO₄, 300 mM NaCl, 20 mM imidazole, pH 8.0)

  • Eluting target proteins with elution buffer (typically containing 50 mM NaH₂PO₄, 300 mM NaCl, 250 mM imidazole, pH 8.0)

Purified proteins should be analyzed by SDS-PAGE to confirm purity and by Western blotting to verify immunoreactivity using convalescent sera from H. parasuis-infected animals .

What are the essential quality control parameters for recombinant H. parasuis proteins?

Quality control for recombinant H. parasuis proteins should include multiple parameters:

  • Purity assessment: SDS-PAGE analysis to confirm protein purity (>90% is typically considered acceptable for immunological studies)

  • Identity confirmation: Western blotting using specific antibodies or convalescent sera

  • Antigenicity verification: Testing reactivity with H. parasuis convalescent sera to confirm proper folding and epitope preservation

  • Endotoxin testing: Limulus Amebocyte Lysate (LAL) assay to ensure endotoxin levels are below 0.1 EU/μg protein

  • Functional assays: Activity tests specific to the protein's function

  • Stability assessment: Analyzing protein stability at different temperatures and storage conditions

For H. parasuis proteins, Western blotting using convalescent sera is particularly important to confirm that recombinant proteins maintain antigenic properties similar to the native proteins .

How do recombinant H. parasuis outer membrane proteins compare in immunogenicity and protective efficacy?

Comparative studies of outer membrane proteins from H. parasuis serovar 5 have demonstrated varying degrees of immunogenicity and protective efficacy. Research methodologies involve:

  • Immunizing mice with purified recombinant proteins (typically 100 μg per dose) emulsified with adjuvants

  • Administering 2-3 doses at 2-week intervals

  • Collecting sera for antibody titer analysis by ELISA

  • Challenging with virulent H. parasuis (typically 1-5 × 10⁹ CFU per mouse)

  • Monitoring survival rates, clinical signs, and bacterial loads in tissues

Recombinant ProteinAntibody Titers (log₂)Survival Rate (%)Bacterial Load Reduction
TolC11-1260Significant
LppC10-1150Moderate
HAPS_092610-1160Significant
Triple-rOMP Combination12-1380Highly significant
OppA8-9<50Limited
HxuC8-9<50Limited

This methodological approach can be applied to study the immunogenicity and protective efficacy of HAPS_0470 compared to other H. parasuis proteins .

What cellular immune responses are elicited by recombinant H. parasuis proteins and how should they be measured?

Recombinant H. parasuis proteins elicit both humoral and cellular immune responses. To properly assess cellular immunity, researchers should employ multiple methodologies:

  • T-cell proliferation assay:

    • Isolate splenocytes from immunized mice

    • Culture with the specific recombinant protein (5-10 μg/ml)

    • Assess proliferation using MTT or BrdU incorporation assays

    • Analyze by flow cytometry using appropriate markers

  • T-cell subset analysis:

    • Stain splenocytes with fluorochrome-labeled antibodies against CD4+ and CD8+ T-cell markers

    • Analyze using flow cytometry to determine the percentages of T-cell subsets

    • Compare vaccinated groups with control groups

  • Cytokine profiling:

    • Collect supernatants from stimulated splenocyte cultures

    • Measure cytokine levels (IFN-γ, IL-2, IL-4, IL-10) using ELISA or cytometric bead array

    • Analyze the Th1/Th2 balance based on cytokine patterns

Recombinant H. parasuis proteins typically induce significant increases in both CD4+ (p < 0.01) and CD8+ (p < 0.05) T-cell subsets compared to control groups, indicating activation of both helper and cytotoxic T-cell responses . This methodological approach should be applied to evaluate the cellular immune responses elicited by HAPS_0470.

What strategies can overcome challenges in expressing and purifying highly hydrophobic bacterial membrane proteins like intracellular septation proteins?

Expressing and purifying highly hydrophobic bacterial membrane proteins presents significant challenges. For proteins similar to intracellular septation protein A, which has been characterized as a small (21 kDa), very hydrophobic protein in related bacteria , the following strategies are recommended:

  • Expression system optimization:

    • Use specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

    • Consider cell-free expression systems for highly toxic proteins

    • Optimize induction conditions (lower IPTG concentrations, lower temperatures)

  • Solubilization approaches:

    • Include appropriate detergents in lysis and purification buffers (DDM, LDAO, or Triton X-100)

    • Try fusion partners that enhance solubility (MBP, SUMO, Trx)

    • Consider extracting proteins directly from membranes using selective detergents

  • Purification modifications:

    • Perform purification at 4°C to minimize aggregation

    • Include glycerol (10-20%) in all buffers to stabilize protein structure

    • Use size exclusion chromatography as a final purification step to remove aggregates

  • Refolding strategies:

    • For inclusion bodies, use gradual dialysis with decreasing concentrations of denaturants

    • Incorporate lipids or lipid-like detergents during refolding to mimic the membrane environment

When working with HAPS_0470, researchers should perform small-scale expression trials to optimize conditions before proceeding to large-scale production for functional and immunological studies.

How can researchers determine if recombinant H. parasuis proteins maintain their native conformation and functional activities?

Determining whether recombinant H. parasuis proteins maintain their native conformation and functional activities requires multiple complementary approaches:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to examine tertiary structure

    • Limited proteolysis to probe folding stability

    • If feasible, X-ray crystallography or cryo-EM for high-resolution structural information

  • Functional assays:

    • For binding proteins, use surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • For enzymatic proteins, develop specific activity assays

    • For membrane proteins, reconstitute in liposomes to test transport or channel activities

  • Immunological verification:

    • Western blotting with convalescent sera or specific antibodies against conformational epitopes

    • ELISA using native protein as a standard for comparison

  • In vitro activity testing:

    • Bactericidal assays using whole blood from immunized animals

    • Cell-based assays relevant to the protein's biological function

For H. parasuis proteins, convalescent sera reactivity in Western blots has been used to confirm proper folding and epitope preservation . Additionally, bactericidal activity assays can demonstrate functional antibody responses against the recombinant proteins, correlating with their protective efficacy.

What are the most effective adjuvant systems for H. parasuis subunit vaccines, and how do they influence the immune response profile?

The selection of appropriate adjuvants significantly impacts the efficacy of H. parasuis subunit vaccines. Based on experimental evidence with H. parasuis outer membrane proteins, the following methodological approaches are recommended:

  • Adjuvant comparison studies:

    • Test multiple adjuvant systems (Freund's, aluminum hydroxide, oil-in-water emulsions, TLR agonists)

    • Immunize mice with identical protein doses but different adjuvants

    • Analyze antibody titers, isotype profiles, and T-cell responses

    • Assess protection against challenge

  • Immune response profiling:

    • Measure antibody isotypes (IgG1, IgG2a, IgG2b) to determine Th1/Th2 balance

    • Analyze cytokine production by stimulated splenocytes (IFN-γ, IL-4, IL-17)

    • Assess memory B and T-cell generation through adoptive transfer experiments

  • Protection correlation:

    • Challenge immunized animals and determine survival rates

    • Measure bacterial loads in tissues following challenge

    • Correlate specific immune parameters with protection levels

What are the optimal challenge models for evaluating protective efficacy of H. parasuis recombinant proteins?

Developing appropriate challenge models is crucial for evaluating the protective efficacy of H. parasuis recombinant proteins. Based on established research protocols, the following methodology is recommended:

  • Animal model selection:

    • Mice models are suitable for initial screening of candidate antigens

    • For definitive efficacy evaluation, piglet models more accurately reflect natural infection

    • Consider age, strain, and immune status of animals

  • Challenge strain preparation:

    • Grow H. parasuis on TSA agar (16 h, 37°C)

    • Select a single colony and inoculate into TSB supplemented with 10% serum and 0.01% NAD

    • Incubate overnight with shaking (37°C)

    • Reinoculate into fresh medium for accurate bacterial counting

  • Challenge protocol:

    • For mice: intraperitoneal administration of 1-5 × 10⁹ CFU per mouse

    • For piglets: intranasal or intratracheal administration of 10⁸-10⁹ CFU

    • Monitor clinical signs, survival rates, and body temperature for 7-14 days

  • Evaluation parameters:

    • Survival rates

    • Clinical score systems

    • Bacterial loads in tissues (spleen, liver, lung) determined by viable counting or PCR

    • Histopathological examination of affected tissues

    • Immunological parameters (antibody titers, cytokine levels)

In murine models, bacterial loads typically peak in the liver and spleen 1-3 days post-challenge, with significantly reduced counts in vaccinated animals by day 7 . This methodological approach provides a comprehensive assessment of protective efficacy.

How can researchers analyze the conservation of HAPS_0470 across different H. parasuis serovars to predict cross-protection?

Analyzing the conservation of HAPS_0470 across different H. parasuis serovars is essential for predicting potential cross-protection. The following methodological approach is recommended:

  • Sequence analysis:

    • Obtain gene sequences from multiple H. parasuis serovars (at least 1-15)

    • Perform multiple sequence alignment using tools like MUSCLE or Clustal Omega

    • Calculate sequence identity and similarity percentages

    • Identify conserved domains and epitope regions

  • Structural prediction and epitope mapping:

    • Use bioinformatic tools to predict protein structure (I-TASSER, AlphaFold)

    • Identify potential B-cell and T-cell epitopes using immunoinformatic approaches

    • Assess the conservation of predicted epitopes across serovars

    • Create a heat map of epitope conservation scores

  • Experimental validation:

    • Express recombinant HAPS_0470 from multiple serovars

    • Perform cross-reactivity studies using sera raised against serovar 5 HAPS_0470

    • Conduct cross-protection studies in animal models

    • Analyze correlations between sequence conservation and protective efficacy

This comprehensive approach provides insights into the potential for HAPS_0470-based vaccines to offer cross-protection against multiple H. parasuis serovars, addressing a key limitation of current vaccines which typically provide serovar-specific protection .

What are the most effective approaches for identifying protective B-cell and T-cell epitopes within HAPS_0470?

Identifying protective B-cell and T-cell epitopes within HAPS_0470 requires a combination of computational prediction and experimental validation approaches:

  • Computational epitope prediction:

    • B-cell epitope prediction using algorithms based on hydrophilicity, flexibility, and surface accessibility

    • MHC-I and MHC-II binding prediction for T-cell epitope identification

    • Conservation analysis across serovars

    • Structural mapping of predicted epitopes

  • Experimental epitope mapping:

    • Peptide microarray analysis using overlapping peptides spanning the entire HAPS_0470 sequence

    • ELISA with sera from convalescent animals to identify immunodominant regions

    • T-cell epitope mapping using splenocytes from immunized animals and overlapping peptides

    • Flow cytometry and ELISPOT assays to detect peptide-specific T-cell responses

  • Epitope validation:

    • Synthesize predicted epitope peptides

    • Conjugate to carrier proteins for immunization

    • Evaluate antibody responses and specificity

    • Assess protective efficacy of epitope-based vaccines

  • Structure-function correlation:

    • Map identified epitopes to the predicted or determined protein structure

    • Analyze accessibility and conservation of epitopes

    • Correlate epitope location with functional domains

This systematic approach identifies the most immunogenic and protective epitopes within HAPS_0470, facilitating the development of epitope-based vaccines or diagnostic tools with potential cross-protection against multiple H. parasuis serovars.

What strategies can resolve contradictory data in H. parasuis vaccine development research?

When faced with contradictory data in H. parasuis vaccine development research, researchers should employ the following methodological approaches:

  • Standardization of experimental protocols:

    • Define standard operating procedures for antigen preparation, immunization, and challenge

    • Ensure consistent protein quality, endotoxin levels, and adjuvant formulations

    • Use standardized readout systems for immune response evaluation

    • Implement positive and negative controls in all experiments

  • Systematic analysis of variables:

    • Identify factors that could explain conflicting results (animal models, bacterial strains, doses)

    • Design factorial experiments to test multiple variables simultaneously

    • Use statistical methods appropriate for multi-factorial experiments

    • Conduct meta-analysis of published studies when applicable

  • Biological replication and validation:

    • Repeat experiments in different laboratories

    • Use different animal models (mice, piglets) to confirm findings

    • Validate in vitro results with in vivo experiments

    • Increase sample sizes to improve statistical power

  • In-depth mechanistic studies:

    • Investigate molecular mechanisms underlying observed phenomena

    • Study the impact of genetic variation in host and pathogen

    • Examine role of commensal microbiota in protection

    • Analyze immune correlates of protection beyond antibody titers

This systematic approach helps resolve contradictions in research data and provides a more robust foundation for H. parasuis vaccine development.

How can researchers overcome the challenges of developing multi-antigen H. parasuis vaccines that include HAPS_0470?

Developing multi-antigen H. parasuis vaccines incorporating HAPS_0470 presents several technical challenges. The following methodological approach addresses these challenges:

  • Antigen selection and compatibility:

    • Screen antigens for immunodominance and potential interference

    • Test combinations in small-scale studies before full-scale evaluation

    • Select antigens with complementary protective mechanisms

    • Consider proteins from different functional categories (adhesins, iron-acquisition systems, etc.)

  • Co-expression and co-purification strategies:

    • Design polycistronic expression systems for multiple antigens

    • Explore fusion protein approaches with appropriate linkers

    • Optimize purification protocols for protein complexes

    • Ensure proper folding of each component in multi-protein formulations

  • Formulation optimization:

    • Test different adjuvant systems suitable for multiple proteins

    • Optimize protein ratios to maximize immune responses to each component

    • Develop stabilization strategies to maintain protein integrity

    • Evaluate different delivery systems (liposomes, nanoparticles)

  • Comprehensive immune response analysis:

    • Assess antibody responses to individual components within the mixture

    • Evaluate T-cell responses to each antigen

    • Analyze potential synergistic or antagonistic effects

    • Correlate immune responses with protection

Research with H. parasuis OMPs has demonstrated that a triple-antigen combination (TolC, LppC, HAPS_0926) elicited stronger immune responses and provided better protection (80% survival) than individual antigens . This suggests that including HAPS_0470 in multi-antigen formulations could potentially enhance vaccine efficacy if compatibility issues are properly addressed.

What are the most sensitive detection methods for monitoring H. parasuis bacterial loads in tissue samples after vaccination and challenge?

Accurate detection and quantification of H. parasuis in tissue samples is critical for evaluating vaccine efficacy. The following methodological approaches are recommended:

  • Culture-based methods:

    • Homogenize tissue samples in appropriate media

    • Perform serial dilutions and plate on selective media

    • Incubate under appropriate conditions (37°C, 5% CO₂, 24-48h)

    • Count colonies and calculate CFU/g of tissue

    • Confirm identity with PCR or immunological methods

  • Molecular detection methods:

    • Extract DNA from tissue samples using commercial kits

    • Perform quantitative PCR targeting H. parasuis-specific genes

    • Include internal controls to normalize extraction efficiency

    • Use standard curves for absolute quantification

    • Consider digital PCR for increased sensitivity and precision

  • Immunohistochemistry:

    • Fix tissue sections in formalin and embed in paraffin

    • Perform antigen retrieval if necessary

    • Stain with H. parasuis-specific antibodies

    • Use digital image analysis for semi-quantitative assessment

    • Combine with histopathological examination

  • Multiplex detection approaches:

    • Develop multiplex PCR to detect different H. parasuis serovars simultaneously

    • Use next-generation sequencing for comprehensive microbiome analysis

    • Apply imaging mass spectrometry for spatial distribution of bacterial components

    • Consider metabolomic approaches to detect bacterial signatures

Research with H. parasuis has shown that bacterial loads in the liver and spleen are typically higher than in the lung following challenge, with significant reductions in vaccinated animals by day 7 post-challenge . This methodological approach provides comprehensive assessment of vaccine-induced protection at the microbiological level.

How might HAPS_0470 be incorporated into novel vaccine delivery systems for enhanced mucosal immunity?

Incorporating HAPS_0470 into novel vaccine delivery systems for enhanced mucosal immunity represents an important future research direction. The following methodological approaches should be considered:

  • Mucosal delivery platforms:

    • Develop microparticle-based systems (PLGA, chitosan) for nasal delivery

    • Explore liposomal formulations with mucosal targeting ligands

    • Investigate virus-like particles as antigen carriers

    • Design live vector systems (attenuated bacteria) expressing HAPS_0470

  • Adjuvant optimization for mucosal delivery:

    • Test mucosal adjuvants (chitosan, CpG ODNs, MPLA)

    • Evaluate cytokine adjuvants targeting mucosal immunity (IL-1α, TSLP)

    • Develop dual-adjuvant systems targeting multiple pathways

    • Assess delivery timing and boosting strategies

  • Immune response evaluation:

    • Measure serum IgG and mucosal IgA responses

    • Analyze T-cell responses in mucosal-associated lymphoid tissues

    • Assess trafficking of immune cells to respiratory mucosa

    • Evaluate long-term memory responses in mucosal tissues

  • Protection studies:

    • Challenge via natural infection routes (intranasal, aerosol)

    • Monitor bacterial colonization of mucosal surfaces

    • Assess clearance rates from respiratory tract

    • Evaluate prevention of systemic spread

This approach addresses a key limitation of current H. parasuis vaccines, which often fail to induce robust mucosal immunity at the primary site of infection. Effective mucosal delivery of HAPS_0470 could potentially enhance protection against initial colonization and subsequent invasion.

What genome-wide approaches can identify regulatory interactions between HAPS_0470 and other virulence factors in H. parasuis?

Understanding the regulatory networks involving HAPS_0470 and other virulence factors requires sophisticated genome-wide approaches. The following methodological strategies are recommended:

  • Transcriptomic analyses:

    • Perform RNA-Seq on wild-type, HAPS_0470 knockout, and complemented strains

    • Analyze under different growth conditions (iron limitation, serum exposure)

    • Identify differentially expressed genes in regulatory networks

    • Validate key findings with RT-qPCR

  • Proteomics approaches:

    • Use quantitative proteomics (TMT, SILAC) to compare protein expression profiles

    • Perform protein-protein interaction studies (pull-down, Y2H, BioID)

    • Analyze post-translational modifications affecting regulation

    • Conduct targeted proteomics for specific regulatory pathways

  • Chromatin immunoprecipitation sequencing (ChIP-Seq):

    • Express tagged versions of regulatory proteins

    • Perform ChIP-Seq to identify DNA binding sites

    • Map regulatory networks controlling HAPS_0470 expression

    • Identify co-regulated virulence genes

  • Functional validation:

    • Generate targeted mutants in key regulatory elements

    • Perform reporter gene assays to validate regulatory interactions

    • Use CRISPR interference for transient gene repression

    • Assess virulence phenotypes in vitro and in vivo

Understanding the regulatory context of HAPS_0470 would provide insights into its role in H. parasuis pathogenesis and potentially identify additional targets for vaccination or therapeutic intervention. This systems biology approach offers a comprehensive view of virulence regulation beyond single-gene studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.