Recombinant Haemophilus parasuis serovar 5 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Haemophilus parasuis and UbiB

Haemophilus parasuis is a Gram-negative bacterium from the Pasteurellaceae family and represents a significant pathogen affecting swine populations globally. This microorganism is the etiological agent of Glässer's disease, a severe condition characterized by fibrinous polyserositis, polyarthritis, and meningitis in pigs . The disease causes substantial economic losses in the swine industry worldwide, necessitating effective prevention and control strategies.

Ubiquinone, also known as coenzyme Q (CoQ), plays vital roles in cellular physiology, particularly in energy generation through electron transport chain processes and as an antioxidant that protects cells from oxidative damage. The UbiB protein is a critical component in the biosynthetic pathway of ubiquinone, specifically involved in the first monooxygenase step . This enzyme belongs to an ancient protein kinase-like family that has been implicated in isoprenoid lipid biosynthesis across diverse species, from bacteria to humans .

The significance of UbiB in bacterial metabolism extends beyond its enzymatic function. Disruption of UbiB activity results in the absence of CoQ and leads to the accumulation of the intermediate octaprenylphenol, indicating the protein's essential role in the progression of the ubiquinone biosynthetic pathway . The conservation of this protein across different bacterial species underscores its fundamental importance in cellular metabolism.

Biochemical Function and Pathway Integration

The UbiB protein plays a pivotal role in ubiquinone biosynthesis, specifically catalyzing the first monooxygenase step in this pathway . This enzymatic activity is critical for the progression from octaprenylphenol to subsequent intermediates in the CoQ biosynthetic pathway. The biochemical function of UbiB is integrally connected to its structural characteristics, particularly its atypical protein kinase-like fold and unique coenzyme preferences.

Despite structural similarities to protein kinases, multiple UbiB-specific features appear positioned to inhibit conventional protein kinase activity . These include the N-terminal domain occupying the typical substrate binding pocket and the A-rich loop that limits ATP binding by establishing selectivity for ADP . These features suggest that UbiB may function through an unconventional mechanism distinct from typical protein kinases, potentially involving protein-protein interactions or secondary enzymatic activities.

Experimental evidence supports the essential nature of UbiB in ubiquinone biosynthesis. Studies with UbiB disruption mutants have demonstrated that these strains lack CoQ and accumulate octaprenylphenol, the intermediate that would normally be processed by the UbiB-mediated reaction . This accumulation pattern definitively places UbiB at a specific position in the biosynthetic pathway and confirms its necessity for complete ubiquinone production.

The integration of UbiB within broader metabolic networks extends beyond ubiquinone biosynthesis. The produced ubiquinone serves dual functions in bacterial physiology:

  1. As an electron carrier in respiratory chains, facilitating energy generation

  2. As an antioxidant that scavenges lipid peroxyl radicals either directly or indirectly through α-tocopherol-mediated mechanisms

This antioxidant function protects bacterial cells from the oxidative damage caused by polyunsaturated fatty acids, suggesting that UbiB indirectly contributes to oxidative stress resistance in H. parasuis.

Recombinant Production and Characterization

The recombinant production of H. parasuis UbiB represents a significant advancement in studying this protein's structure, function, and potential applications. While specific production methods for H. parasuis UbiB are not detailed in the available literature, general approaches for recombinant protein expression can be inferred from related proteins.

Based on production methods for similar proteins, the recombinant H. parasuis UbiB is likely expressed in Escherichia coli expression systems using vectors that facilitate the addition of affinity tags for purification purposes . Common expression systems include BL21(DE3) E. coli strains with pET-based vectors that allow IPTG-inducible expression.

The purification of recombinant UbiB typically involves affinity chromatography, leveraging tags such as polyhistidine (His-tag) for selective binding to metal affinity resins . This approach enables efficient separation of the target protein from the complex bacterial lysate. Additional purification steps may include ion exchange chromatography and size exclusion chromatography to achieve high purity.

For optimal storage and stability, recombinant proteins are often maintained in specific buffer conditions. Drawing from information about similar proteins, recombinant UbiB may be stored in Tris/PBS-based buffers containing stabilizing agents such as trehalose at pH 8.0 . Long-term storage typically involves maintaining the protein at -20°C or -80°C, with glycerol addition (typically 5-50%) to prevent freeze-thaw damage . Repeated freeze-thaw cycles are generally avoided to maintain protein integrity.

The characterization of recombinant UbiB would typically include:

  1. SDS-PAGE analysis to confirm purity and approximate molecular weight

  2. Western blotting to verify identity using specific antibodies

  3. Functional assays to assess enzymatic activity

  4. Structural analysis through techniques such as circular dichroism or X-ray crystallography

These characterization steps provide essential information about the protein's properties and quality, ensuring its suitability for subsequent applications.

Future Research Directions and Applications

The study of recombinant H. parasuis UbiB presents numerous opportunities for future research with potential applications in both basic science and applied fields. Several promising directions warrant investigation:

The detailed structural characterization of H. parasuis UbiB would significantly advance understanding of its function. X-ray crystallography or cryo-electron microscopy studies could reveal the precise three-dimensional arrangement of the protein, providing insights into its mechanism of action and potential interaction partners. Comparative structural analysis with UbiB proteins from other species could identify conserved features essential for function versus species-specific adaptations.

Functional studies focusing on the enzymatic activity of UbiB would address fundamental questions about its biochemical role. Development of in vitro assays to directly measure UbiB activity would overcome historical challenges in demonstrating its enzymatic function. Site-directed mutagenesis experiments targeting key residues, particularly within the A-rich loop region, could elucidate structure-function relationships and potentially modify the protein's properties for biotechnological applications.

The exploration of UbiB as a vaccine component represents a particularly promising applied research direction. Evaluation of its immunogenicity in swine models, both alone and in combination with other antigens, could establish its efficacy in stimulating protective immunity against H. parasuis infection. Assessment of different adjuvant formulations and delivery systems would optimize vaccine potency and duration of protection.

Investigating the role of UbiB in H. parasuis pathogenesis could reveal its contribution to bacterial virulence. Comparative studies of UbiB expression and activity across different H. parasuis serovars might identify correlations with virulence levels. Generation of UbiB deletion or conditional mutants would enable direct assessment of its necessity for infection and disease progression in appropriate animal models.

The development of UbiB-targeted antimicrobials represents another potential application. Given UbiB's essential role in bacterial metabolism and its structural differences from mammalian homologs, it could serve as a selective target for novel antibacterial compounds. High-throughput screening of chemical libraries for UbiB inhibitors might identify lead compounds for further development as therapeutics against H. parasuis infections.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; HAPS_1373; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Haemophilus parasuis serovar 5 (strain SH0165)
Target Names
ubiB
Target Protein Sequence
MNIKNLRRLYNIIHTFLRYGIDEVIPDIPLTRGIRCGRKSLFWVKNQYPNEPFGVRLRLA LQELGPVWIKLGQMLSTRRDLFEPELADQLALLQDSVEAFDGKLARRLIEEALGDKLEKW FDDFDETALASASIAQVHIAKFNQNQPLAGKEVVLKVLRPEIERVIKDDLALMYRLASWI PRLNKEGRRLRPVEVVREYEKTLLDELDLRKEMVNAIRLRNNFENSEMLYVPEMYQEFCH KNVIVMERIYGIPVANIDELKANGTDMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVN PNHPENPQYIGIDCGIVGTLNQNDKRYLAESFVAFFNRDYRRVALMHVESGWTPADTDID AFEEAFREVCEPIFAKPLSEISFGHVLLNLFTVARKFNMEVQPQLVLLQKTLLYIEGLGR QVYPQLDLWQTAKPFLQDWLNEQVGFKAMWRDLKQRAPQFREHFAEFPEAMFQALQQQKQ INFRLNEINQSLKAQRNNTGFSRLMILGIAIAGTFWKFEMLPLWVSVPLLVIEFRILIWC MSFSNNSYS
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which plays a role in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Haemophilus parasuis and why is serovar 5 significant in research?

Haemophilus parasuis (also known as Glaesserella parasuis) is the bacterial pathogen responsible for Glässer's disease, characterized by fibrinous polyserositis, polyarthritis, and meningitis in pigs. Serovar 5 is particularly significant in research because it is classified as a highly virulent serovar with worldwide prevalence . Studies comparing different serovars have demonstrated that serovar 5 exhibits the strongest virulence in piglets, followed by serovars 13, 4, and 12 . This high virulence makes serovar 5 an important target for vaccine development and pathogenicity studies, as controlling this particular serovar could significantly reduce economic losses in the swine industry.

What is the ubiquinone biosynthesis protein UbiB and what is its role in bacterial metabolism?

UbiB is a protein involved in the biosynthesis pathway of ubiquinone (also known as coenzyme Q), which plays a critical role in bacterial respiratory electron transport chains. The UbiB protein possesses ATPase activity and functions as part of a multiprotein ubiquinone biosynthesis complex . This complex is essential for energy production in bacteria across various oxygen conditions. In the context of bacterial metabolism, UbiB contributes to the organism's ability to adapt to different oxygen environments, which is particularly important for pathogens that must navigate varying oxygen levels during host infection. Understanding UbiB's function provides insights into bacterial bioenergetics and potential vulnerabilities that could be targeted for antimicrobial development.

What are the common experimental models used to study H. parasuis pathogenicity?

Two primary experimental models are used to study H. parasuis pathogenicity: mouse models and piglet models. Each presents specific advantages and limitations:

Piglet Model:
Colostrum-deprived piglets are considered the gold standard experimental model for H. parasuis research, as pigs are the natural host for this pathogen. Studies challenging piglets with a lethal dose of H. parasuis serovar 5 provide more clinically relevant data . Research has demonstrated that virulence test results in piglets better reflect the actual pathogenicity of common strains, with serovar 5 consistently showing the highest virulence levels .

A comparative study across 36 strains from four common serovars (4, 5, 12, and 13) concluded that BALB/c mice are inadequate as an alternative model for H. parasuis infection research due to the inconsistent correlation between mouse and piglet virulence results .

How do oxygen-dependent and oxygen-independent ubiquinone biosynthesis pathways differ in proteobacteria?

Recent research has revealed two distinct pathways for ubiquinone biosynthesis in proteobacteria that function under different oxygen conditions:

Oxygen-Dependent Pathway:
The traditional ubiquinone biosynthesis pathway requires molecular oxygen (O₂) as a substrate for hydroxylation reactions. This pathway has been well-characterized and relies on oxygen-dependent hydroxylases to perform key modifications to the quinone ring structure.

Oxygen-Independent Pathway:
A novel oxygen-independent pathway has been identified that allows bacteria to synthesize ubiquinone even in anoxic environments. This pathway involves three proteins:

  • UbiT (YhbT): Contains an SCP2 lipid-binding domain and likely functions as an accessory factor

  • UbiU (YhbU) and UbiV (YhbV): Form a heterodimer complex that acts as a novel class of O₂-independent hydroxylases

The UbiU-UbiV complex is particularly interesting as each protein binds a 4Fe-4S cluster via conserved cysteines that are essential for activity. This allows for hydroxylation reactions to occur without molecular oxygen as a substrate .

The presence of both pathways in many proteobacteria, including several human pathogens, suggests an evolutionary adaptation that enables these bacteria to synthesize ubiquinone across the entire O₂ range. This dual-pathway system provides metabolic flexibility for bacteria that encounter varying oxygen levels during infection or environmental colonization. For H. parasuis, which must adapt to different microenvironments during infection, this metabolic versatility likely contributes to its pathogenicity .

What expression systems and purification methods are most effective for producing recombinant H. parasuis UbiB protein?

Based on current protocols for similar recombinant proteins, the following expression and purification approaches are recommended for H. parasuis UbiB:

Expression Systems:

  • E. coli expression system: The most commonly used system due to its high yield, rapid growth, and well-established protocols. For UbiB, E. coli BL21(DE3) or Rosetta strains are typically employed to address potential codon usage issues .

  • Fusion tag selection: His-tag fusion is commonly used for UbiB proteins to facilitate purification and detection. The tag is typically placed at the N-terminus to avoid interference with protein function .

Purification Protocol:

  • Cell lysis: Using sonication or French press in a buffer containing protease inhibitors

  • Affinity chromatography: Ni-NTA resin for His-tagged proteins

  • Size exclusion chromatography: To remove aggregates and ensure protein homogeneity

  • Verification of purity: SDS-PAGE analysis with target purity >90%

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

This approach has been successfully applied to similar proteins and provides a starting point for researchers working with H. parasuis UbiB.

How can recombinant UbiB protein be evaluated for potential vaccine development against H. parasuis infections?

Evaluating recombinant UbiB as a vaccine candidate against H. parasuis requires a systematic approach:

1. Antigenicity Assessment:

  • Bioinformatics analysis to identify putative cytotoxic T-lymphocyte (CTL) epitopes and B-cell antigenic determinants

  • Western blotting assays to confirm immunogenicity of the recombinant protein

2. Immunological Response Evaluation:

  • Measure antibody levels post-vaccination

  • Assess cytokine profiles, particularly IL-2, IL-4, and IFN-γ levels

  • Analyze both humoral and cellular immune responses

3. Challenge Studies:

  • Mouse model: Initial screening using intraperitoneal injection of H. parasuis (typically 6.5×10⁹ CFU, equivalent to 5×LD₅₀)

  • Piglet model: Definitive evaluation using colostrum-deprived piglets

4. Protection Assessment:

  • Monitor survival rates

  • Evaluate histopathological lesions

  • Test antisera for growth inhibition of H. parasuis in vitro

  • Compare with established vaccine formulations

Research with similar outer membrane proteins (OMPs) from H. parasuis has shown promising results. For example, recombinant proteins from the hxuCBA gene cluster demonstrated strong immune responses and protection against challenge. Specifically, HxuC and HxuB proteins showed significant protective effects comparable to whole-cell inactivated vaccines .

When developing UbiB-based vaccines, researchers should consider two formulation approaches that have shown success with other H. parasuis proteins:

  • Adjuvanted formulations using mineral oil (e.g., Montanide IMS 2215 VG PR)

  • Bacterial neuraminidase-potentiated formulations (e.g., using Clostridium perfringens neuraminidase)

What is the relationship between UbiB function and H. parasuis virulence across different oxygen environments?

The relationship between UbiB function and H. parasuis virulence across oxygen environments represents an important research frontier. Current evidence suggests several key connections:

Adaptation to Varying Oxygen Conditions:
H. parasuis encounters numerous microenvironments with different oxygen levels during infection, from oxygen-rich respiratory surfaces to oxygen-limited tissues during systemic infection. The ubiquinone biosynthesis system, including UbiB, enables metabolic flexibility across these oxygen gradients . Serovar 5, known for its high virulence, may possess optimized ubiquinone biosynthesis pathways that contribute to its pathogenicity.

Energy Production During Infection:
Efficient energy generation is crucial for bacterial pathogenesis. UbiB's role in ubiquinone biosynthesis directly impacts the bacterium's ability to maintain cellular energetics under stressful conditions encountered during infection. Ubiquinone serves as an electron carrier in respiratory chains, and its production is essential for H. parasuis survival and virulence expression .

Potential Virulence Mechanism:
The connection between metabolic adaptation and virulence has been established in multiple bacterial pathogens. For H. parasuis, the ability to synthesize ubiquinone via both oxygen-dependent and oxygen-independent pathways may represent a virulence determinant that allows the bacterium to persist throughout infection. This metabolic flexibility could contribute to the higher virulence observed in serovar 5 strains .

Research Implications:
Understanding the link between UbiB function and virulence opens avenues for novel therapeutic approaches. Inhibiting UbiB or other components of the ubiquinone biosynthesis pathway could potentially attenuate H. parasuis virulence. Furthermore, genetically modified strains with altered UbiB function could serve as attenuated live vaccine candidates.

What are the optimal conditions for expressing and purifying recombinant H. parasuis UbiB protein?

Based on protocols developed for similar proteins, the following optimized conditions are recommended:

Expression Conditions:

ParameterOptimized Condition
Expression HostE. coli BL21(DE3)
Expression VectorpET series with N-terminal His-tag
Induction0.5-1.0 mM IPTG
Temperature16-18°C
Induction Duration16-18 hours
MediaLB with appropriate antibiotics

Purification Conditions:

StepConditions
Cell LysisSonication in Tris/PBS-based buffer (pH 8.0) with protease inhibitors
Affinity ChromatographyNi-NTA resin, elution with 250-300 mM imidazole
Buffer ExchangeDialysis against Tris/PBS-based buffer (pH 8.0)
StorageLyophilization or in Tris/PBS-based buffer with 6% trehalose

Quality Control Metrics:

  • Purity: >90% as determined by SDS-PAGE

  • Yield: Typically 2-10 mg per liter of culture

  • Activity: Verification of ATPase activity through biochemical assays

How can researchers assess UbiB's contribution to the oxygen-independent ubiquinone biosynthesis pathway?

To evaluate UbiB's role in oxygen-independent ubiquinone biosynthesis, researchers should employ the following methodological approaches:

Genetic Approaches:

  • Generate UbiB knockout mutants in H. parasuis

  • Conduct complementation studies with wild-type and mutated UbiB variants

  • Perform growth assessments under aerobic and anaerobic conditions

  • Quantify ubiquinone production in each strain using HPLC or LC-MS/MS

Biochemical Characterization:

  • Purify recombinant UbiB and assess its ATPase activity

  • Identify protein interaction partners using pull-down assays or co-immunoprecipitation

  • Reconstitute the ubiquinone biosynthesis pathway in vitro with purified components

  • Analyze substrate specificity and enzymatic parameters

Structural Studies:

  • Determine the three-dimensional structure of UbiB using X-ray crystallography or cryo-EM

  • Identify conserved domains involved in protein-protein interactions

  • Map ATP binding sites and catalytic residues

  • Compare structures under different redox conditions

In vivo Assessment:

  • Monitor ubiquinone levels in wild-type and UbiB-deficient strains across oxygen gradients

  • Conduct transcriptomic and proteomic analyses to identify compensatory pathways

  • Assess virulence of UbiB mutants in experimental infection models

  • Evaluate metabolic profiles using ¹³C-labeled substrates and metabolomic approaches

These methodologies will help elucidate UbiB's precise role in the oxygen-independent ubiquinone biosynthesis pathway and its contribution to H. parasuis metabolism and virulence.

How should researchers interpret conflicting virulence data between mouse and piglet models?

When faced with discrepancies in virulence data between mouse and piglet models, researchers should apply the following interpretative framework:

Model-Specific Pathological Mechanisms:
The distinct pathological mechanisms in each model explain many data discrepancies. In BALB/c mice, H. parasuis predominantly causes death through internal organ bleeding, whereas in piglets, the pathology more closely resembles natural Glässer's disease, with fibrinous polyserositis, polyarthritis, and meningitis . These fundamental differences in disease progression explain why virulence rankings may differ between models.

Strain-Specific Variability:
Research has shown that "even the same strain of G. parasuis could display different virulence in mice and piglets" . This strain-specific variability necessitates careful interpretation when extrapolating between models.

Data Integration Approach:
Researchers should:

  • Acknowledge the model-specific limitations in all publications

  • Use mouse models primarily for preliminary screening or mechanism studies

  • Validate key findings in the more clinically relevant piglet model

  • Consider developing in vitro systems that better predict in vivo virulence

  • Report virulence data with model-specific context rather than as absolute measures

What statistical approaches are most appropriate for analyzing immune responses to recombinant UbiB vaccination?

When analyzing immune responses to recombinant UbiB vaccination, the following statistical approaches are recommended:

For Antibody Titer Analysis:

  • Repeated measures ANOVA to assess changes in antibody levels over time post-vaccination

  • Post-hoc tests (Tukey's or Bonferroni) to determine significant differences between vaccination timepoints

  • Non-parametric alternatives (Friedman test with Dunn's multiple comparisons) when data do not meet normality assumptions

For Cytokine Level Evaluation:

  • Two-way ANOVA to examine the effects of vaccination and time on cytokine production (particularly IL-2, IL-4, IFN-γ)

  • Multiple comparison corrections to account for analysis of multiple cytokines

  • Linear mixed models to account for repeated measures and individual variation

For Challenge Study Outcomes:

  • Kaplan-Meier survival analysis with log-rank test to compare protection rates between vaccinated and control groups

  • Fisher's exact test for comparing categorical outcomes (protected vs. not protected)

  • Quantification of bacterial load using qPCR data should be analyzed with non-parametric Mann-Whitney U tests due to typically non-normal distributions

For Histopathological Assessments:

  • Develop and apply standardized scoring systems for lesion severity

  • Use ordinal regression models for analyzing scored histopathological data

  • Employ blinded assessment protocols to reduce observer bias

Power Analysis Considerations:
Given the variability observed in immune responses to H. parasuis antigens, sample size calculations should aim for 80-90% power to detect meaningful differences. For initial studies in mice, group sizes of 8-10 animals are typically required, while piglet studies may require 6-8 animals per group depending on expected effect sizes .

What are the emerging research areas for H. parasuis UbiB protein and ubiquinone biosynthesis?

Several promising research directions are emerging in the study of H. parasuis UbiB and ubiquinone biosynthesis:

Structural Biology Approaches:

  • Cryo-EM studies of the entire ubiquinone biosynthesis complex to understand protein-protein interactions

  • Structure-based drug design targeting UbiB and related proteins as novel antimicrobial approaches

  • Mapping of conformational changes in UbiB during ATP hydrolysis and substrate binding

Systems Biology Integration:

  • Multi-omics approaches (transcriptomics, proteomics, metabolomics) to understand how ubiquinone biosynthesis pathways respond to environmental changes

  • Network analysis to identify regulatory connections between ubiquinone biosynthesis and virulence gene expression

  • Mathematical modeling of bacterial energy metabolism across oxygen gradients

Immunological Studies:

  • Identification of immunodominant epitopes within UbiB for epitope-focused vaccine design

  • Investigation of UbiB's potential role in modulating host immune responses

  • Development of UbiB-based serological assays for improved diagnostics

Therapeutic Applications:

  • Design of small molecule inhibitors specifically targeting the oxygen-independent ubiquinone biosynthesis pathway

  • Exploration of UbiB as a carrier protein for conjugate vaccines

  • CRISPR-Cas9 approaches for generating attenuated vaccine strains with modified UbiB function

How might comparative genomics inform our understanding of UbiB function across different H. parasuis serovars?

Comparative genomics approaches offer powerful insights into UbiB function across H. parasuis serovars:

Sequence Conservation Analysis:

  • Alignment of UbiB sequences across all 15 serovars to identify conserved domains and variable regions

  • Correlation between sequence variations and virulence phenotypes

  • Identification of serovar-specific adaptations in UbiB structure

Genomic Context Examination:

  • Analysis of the genomic neighborhood around the ubiB gene

  • Identification of potential operon structures and co-regulated genes

  • Comparison of regulatory elements controlling ubiB expression across serovars

Pan-genome Approaches:

  • Determination of whether ubiB belongs to the core or accessory genome

  • Analysis of horizontal gene transfer events affecting ubiquinone biosynthesis genes

  • Identification of serovar-specific gene gain/loss events affecting metabolic pathways

Functional Prediction:

  • Prediction of functional consequences of UbiB sequence variations using computational approaches

  • Analysis of selection pressures acting on ubiB across different H. parasuis lineages

  • Investigation of potential compensatory mutations in related ubiquinone biosynthesis genes

By leveraging these comparative genomics approaches, researchers can develop hypotheses about the evolution of UbiB function and its contribution to the differential virulence observed among H. parasuis serovars, particularly the high virulence associated with serovar 5 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.