Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please let us know and we will prioritize developing the specified tag.
Synonyms
lgt; HAPS_2257; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Haemophilus parasuis serovar 5 (strain SH0165)
Target Names
lgt
Target Protein Sequence
MSEQFLTFPNIDPVALQLGPVSLHWYGIMYLLGFGFAYWLGTKRAKNSNGVWSVEQVDQL LFNGFWGVVLGGRIGDVFFYSFDRFLQDPLYLFRIWEGGMSFHGGLLGVIVAMLWTSRRQ NRNFWQTADFIAPLIPFGLGLGRIGNFINDELWGRVTDVPWAIMFPSGGYLPRHPSQLYE AVLEGLVLFFILNGYIRKPRPTGSVAGLFLVGYGVFRFIVEYFREFDPNVNTAADLITRG QLLSLPMIIGGLVIMVVAYYRHRLSND
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, representing the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus parasuis serovar 5 and why is it significant in research?

Haemophilus parasuis is a gram-negative bacterium that causes Glässer's disease in swine. There are 15 distinct serologic groups (serovars) of H. parasuis, with serovar 5 being one of the most virulent . Studies have shown that cells of strains representing serovar 5 are among the most virulent, causing death or moribundity in inoculated pigs . This serovar, along with serovar 4, accounts for approximately 41% of field isolates in some regions, making it a significant target for vaccine development . The high prevalence and virulence of serovar 5 have made it a focal point for researchers seeking to understand pathogenesis mechanisms and develop effective cross-protective vaccines.

What is the role of prolipoprotein diacylglyceryl transferase (Lgt) in bacterial physiology?

Prolipoprotein diacylglyceryl transferase (Lgt) is a critical enzyme in the lipoprotein maturation pathway of gram-negative bacteria including H. parasuis. Lgt catalyzes the first step in lipoprotein processing by transferring a diacylglycerol moiety to the thiol group of the cysteine residue within the lipobox of preprolipoproteins . This modification results in prolipoproteins, which are then further processed by lipoprotein signal peptidase (Lsp) . The mature lipoproteins play diverse roles in bacterial physiology, including nutrient acquisition, signal transduction, antibiotic resistance, and host-pathogen interactions. Lgt's function is essential for proper lipoprotein localization and functionality, making it an important factor in bacterial survival and virulence.

How do researchers differentiate between virulent and avirulent H. parasuis strains?

Researchers typically employ a combination of methods to differentiate between virulent and avirulent H. parasuis strains:

  • In vivo challenge models: Intraperitoneal inoculation of specific-pathogen-free pigs with cells representing different serovars reveals differences in virulence. For example, strains of serovars 1, 5, 10, 12, 13, and 14 have been shown to be most virulent, causing death or severe illness, while strains from serovars 3, 6, 7, 9, and 11 produce no clinical symptoms or lesions indicative of H. parasuis infection .

  • Molecular characterization: Analysis of specific virulence genes, including those encoding lipoproteins and their processing enzymes like Lgt.

  • Immunological profiling: Assessment of the strain's ability to evade host immune responses, often involving the characterization of surface antigens and their modifications by enzymes like Lgt.

These approaches help identify strains appropriate for vaccine development and virulence studies.

How are recombinant Lgt proteins from H. parasuis serovar 5 produced for research purposes?

The production of recombinant Lgt protein from H. parasuis serovar 5 typically follows this methodological approach:

  • Gene amplification: The entire lgt gene is amplified from genomic DNA of H. parasuis serovar 5 using PCR with specific primers designed based on the published genome sequence .

  • Cloning: The amplified gene is cloned into expression vectors such as pET systems or pCR2.1 followed by subcloning into expression vectors .

  • Expression optimization: Recombinant proteins are expressed in E. coli hosts (commonly BL21(DE3)) under optimized conditions to maximize protein yield while maintaining solubility. This typically involves testing various temperatures, induction times, and IPTG concentrations.

  • Protein purification: The recombinant Lgt is purified using affinity chromatography (commonly His-tag/Ni-NTA), followed by additional purification steps such as ion-exchange or gel filtration chromatography if needed.

  • Quality assessment: The purified protein undergoes SDS-PAGE, Western blotting, and mass spectrometry analysis to confirm identity, purity, and integrity.

This methodology yields purified recombinant Lgt protein suitable for immunological studies and vaccine development research.

What techniques are employed to create lgt gene knockout mutants in H. parasuis?

Creating lgt gene knockout mutants in H. parasuis involves a precise in-frame deletion methodology as demonstrated in the research literature:

  • Splicing-by-overlap-extension PCR: This technique is used to create DNA fragments flanking the lgt gene but excluding the gene itself . Two PCR fragments are generated from regions upstream and downstream of the target gene, designed with complementary overhangs.

  • Vector construction: The overlapping PCR products are cloned into intermediary vectors like pCR2.1, then extracted with appropriate restriction enzymes (e.g., EcoRI) and recloned into thermosensitive shuttle plasmids such as pSET4s .

  • Transformation: The knockout vector (e.g., p4Δlgt) is introduced into H. parasuis by electroporation.

  • Allelic exchange: Through a two-step selection process involving temperature shifts and antibiotic selection, mutants with the desired gene deletion are isolated.

  • Verification: Allelic replacement is confirmed through PCR analysis and DNA sequencing to ensure precise deletion without affecting surrounding genes .

This approach allows researchers to study the specific roles of Lgt in H. parasuis virulence and physiology by comparing the wild-type strain with its isogenic lgt deletion mutant.

How are complementation studies conducted to verify gene function in lgt mutants?

Complementation studies are essential to confirm that observed phenotypes in lgt mutants are directly attributable to the absence of the lgt gene. The methodology typically includes:

  • Complementation vector construction: The entire functional lgt gene is amplified from genomic DNA of the wild-type H. parasuis strain and cloned into a complementation vector such as pMX1, which contains an appropriate promoter for expression in H. parasuis (e.g., the malX promoter) .

  • Verification of insert: The complementation construct (e.g., pMX1-lgt) is first introduced into E. coli for sequence verification to ensure no mutations were introduced during the cloning process .

  • Introduction into mutant: The verified complementation vector is then transformed into the lgt deletion mutant strain.

  • Phenotype restoration assessment: The complemented mutant is tested alongside the wild-type and deletion mutant strains for:

    • Growth characteristics

    • Virulence in animal models

    • Cellular immune responses

    • Lipoprotein processing capability

    • Adhesion and invasion abilities

    • Biofilm formation

  • Expression confirmation: Western blotting or RT-qPCR is used to confirm that the complementation restored Lgt expression.

Complete restoration of the wild-type phenotype in the complemented strain confirms the specific role of the lgt gene in the observed mutant phenotypes.

How does recombinant Lgt from H. parasuis serovar 5 induce immunological responses?

Recombinant Lgt from H. parasuis serovar 5 induces complex immunological responses through multiple pathways:

  • Humoral immunity: Immunization with recombinant Lgt elicits strong antibody responses, with studies showing significant production of specific IgG antibodies in mice . This is comparable to other outer membrane proteins that have been investigated as vaccine candidates.

  • Cellular immunity: Lgt stimulates both Th1 and Th2 immune responses. Studies with similar H. parasuis immunogenic proteins have documented significant increases in cytokine levels including IL-2 and IFN-γ (Th1-associated) and IL-4 (Th2-specific) in culture supernatants of splenocytes from immunized mice .

  • IgG subtype profile: Analysis of IgG subtypes reveals that Lgt induces a bias toward a Th1-type immune response, though both Th1 and Th2 responses appear to be involved in mediating protection .

  • Dendritic cell activation: Lgt and its processed lipoproteins can activate dendritic cells, an important step in initiating adaptive immune responses. This activation is influenced by the genetic background of the bacterial strain .

Understanding these immunological mechanisms is crucial for developing effective subunit vaccines using Lgt as an antigen.

What in vivo models are used to evaluate the protective efficacy of recombinant Lgt vaccines?

The evaluation of protective efficacy of recombinant Lgt-based vaccines typically employs these animal models and assessment protocols:

  • Mouse challenge model: This is the most common initial model used to assess protective efficacy. The general protocol includes:

    • Immunization schedule: Typically 2-3 doses of recombinant protein with appropriate adjuvants at 2-week intervals

    • Challenge: Intraperitoneal inoculation with virulent H. parasuis serovar 5 strains (usually 10^9 CFU)

    • Survival monitoring: For 7-10 days post-challenge

    • Protection assessment: Based on survival rates and bacterial burden in organs

  • Bacterial load quantification: Recombinant Lgt vaccines have demonstrated ability to reduce bacterial growth in mouse organs, with protection rates ranging from 40-80% against challenge, similar to other investigated proteins .

  • Cytokine profile analysis: Measurement of cytokines in serum and from stimulated splenocytes provides insights into the type of immune response generated.

  • Pig models for advanced testing: While initial screening often uses mice, the pig model is the gold standard for confirming efficacy, as it is the natural host. This typically involves:

    • Vaccination of specific-pathogen-free pigs

    • Homologous and heterologous challenge with different serovars

    • Clinical scoring and pathological examination

These models help determine whether recombinant Lgt can provide cross-protection against multiple H. parasuis serovars.

How do mutations in the lgt gene affect lipoprotein localization and bacterial virulence?

The impact of lgt mutations on lipoprotein localization and bacterial virulence involves complex mechanisms:

  • Lipoprotein processing disruption: In lgt mutants, prelipoproteins cannot be lipidated, resulting in aberrant processing and localization. This leads to:

    • Accumulation of unprocessed prelipoproteins

    • Mislocalization of proteins that should be anchored to the membrane

    • Potential release of normally membrane-bound lipoproteins into the extracellular environment

  • Virulence attenuation: Research indicates that Lgt plays a differential role in virulence depending on the genetic background of the strain. For example:

    • In some sequence types (STs), Lgt appears to be more critical for virulence than in others

    • The enzyme's role may be more pronounced in North American H. parasuis serotype 2 ST25 strains where capsular polysaccharides (CPS) only partially mask subcapsular domains

  • Host interaction alterations: Lgt mutants show modified interactions with host cells, including:

    • Reduced adhesion to epithelial and endothelial cells

    • Altered biofilm formation capacity, independent of the strain's sequence type

    • Modified dendritic cell activation patterns, with potentially strain-dependent effects

These findings indicate that Lgt plays a multifaceted role in H. parasuis virulence, affecting both bacterial physiology and host-pathogen interactions.

What molecular mechanisms underlie the immunoprotective effects of recombinant Lgt?

The molecular mechanisms behind the immunoprotective effects of recombinant Lgt are multifaceted:

  • Recognition by pattern recognition receptors: As a bacterial lipoprotein maturation enzyme, Lgt-processed lipoproteins are recognized by Toll-like receptors (particularly TLR2) on host immune cells, triggering innate immune responses that eventually promote adaptive immunity.

  • MHC presentation pathways: Processed Lgt-derived peptides are presented via:

    • MHC class II pathways after uptake by antigen-presenting cells, leading to CD4+ T-cell activation

    • Cross-presentation via MHC class I, potentially activating CD8+ T-cells

  • Cytokine profile modulation: Immunization with recombinant Lgt and similar proteins induces:

    • Increased IL-2 and IFN-γ production, promoting Th1 responses

    • Elevated IL-4 levels, supporting Th2 responses

    • A balanced immune profile that contributes to effective protection

  • Antibody effector functions: Anti-Lgt antibodies may:

    • Neutralize the enzyme's function, potentially interfering with proper lipoprotein processing

    • Facilitate opsonization and phagocytosis of bacteria

    • Activate complement-mediated bacterial killing

  • Memory immune cell generation: Recombinant Lgt stimulates the development of memory B and T cells, providing long-term protection against subsequent H. parasuis infection.

These mechanisms collectively contribute to the observed protective efficacy of 40-80% in animal models vaccinated with recombinant Lgt and similar proteins .

What strategies are being explored to improve the efficacy of Lgt-based vaccines?

Several innovative approaches are being investigated to enhance the efficacy of Lgt-based vaccines against H. parasuis:

  • Multi-component subunit vaccines: Combining Lgt with other immunogenic proteins has shown promise. Research indicates that five secreted proteins with high immunogenicity, similar to Lgt, could serve as potential subunit vaccine candidates, with protection rates ranging from 40-80% . These combinatorial approaches may provide broader protection across different serovars.

  • Adjuvant optimization: Studies are exploring various adjuvants to enhance immune responses to Lgt, including:

    • Oil-in-water emulsions for balanced Th1/Th2 responses

    • TLR agonists to boost innate immune activation

    • Nanoparticle-based delivery systems for improved antigen presentation

  • Structural modifications: Engineering the Lgt protein to expose critical epitopes while removing regions that might induce non-protective responses.

  • Delivery systems development: Investigating various delivery platforms including:

    • Viral vector-based systems

    • DNA vaccines encoding Lgt

    • Bacterial outer membrane vesicles (OMVs) incorporating Lgt

  • Immunoproteomic approaches: Using techniques such as 2-DE, MALDI-TOF/TOF MS, and Western-blot to identify additional immunogenic proteins that could complement Lgt in a multi-component vaccine . This approach has already identified six highly immunogenic secreted proteins from H. parasuis.

These strategies aim to overcome the limitations of current vaccines, which fail to provide cross-protection against all 15 serovars of H. parasuis, addressing a critical need in the swine industry .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.