Recombinant Haemophilus parasuis serovar 5 Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements for preferential development.
Synonyms
htpX; HAPS_0810; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Haemophilus parasuis serovar 5 (strain SH0165)
Target Names
htpX
Target Protein Sequence
MMRIALFLATNFAVMIVLGIILSVTGIAGNSTGGILIMSVLFGFAGSLISLFMSKTMALK SVGAEIITEPRNNAERWLVETVKRQSQQAGIPMPDVAIYHSADVNAFATGATKSNSLVAV STGLLNTMTEDEAEAVVAHEVAHIANGDMVTMTLLQGVLNTFVIFLSRMIATAVSSSRND DGEETQSSGTYFLVSMVLEILFGVLATIIAMWFSRYREFRADAGSAQLVGKEKMIAALQR LQRVHDPEELPGSLNAMMINGKAKEFFMSHPPLEKRIEALRNL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of HtpX protease in Haemophilus parasuis?

HtpX in H. parasuis, similar to its homologs in other bacteria like Bacillus subtilis, is likely an integral membrane metalloprotease. The protein contains a characteristic zinc-binding motif, HEXXH (where X represents any amino acid), with the glutamic acid residue serving as the catalytic site . This protease is predicted to have membrane-spanning domains and functions in protein quality control mechanisms, particularly in response to heat and other stresses. The functional significance of HtpX is highlighted in bacterial stress responses where it may contribute to degrading misfolded membrane proteins.

How is the htpX gene regulated in bacterial systems?

The regulation of htpX has been extensively studied in model organisms like Bacillus subtilis. Research indicates that htpX expression is under dual negative control by transcriptional regulators such as Rok and YkrK . Furthermore, htpX expression shows strong heat inducibility, suggesting its role in stress response pathways . The promoter region contains specific sequence elements, including conserved inverted repeat sequences that serve as binding sites for regulators like YkrK . The heat induction of htpX appears to be independent of YkrK-mediated regulation, indicating multiple regulatory pathways controlling this gene's expression .

What are the optimal methods for cloning and expressing recombinant HtpX from H. parasuis serovar 5?

For efficient cloning and expression of recombinant HtpX from H. parasuis serovar 5, researchers should follow a methodology similar to that used for other outer membrane proteins. Based on successful approaches with other H. parasuis proteins, the recommended protocol includes:

  • Genomic DNA extraction from H. parasuis serovar 5 culture

  • PCR amplification of the htpX gene using specific primers designed from reference sequences

  • Cloning into an expression vector containing a histidine tag sequence for purification

  • Transformation into an E. coli expression host (typically BL21 or similar strains)

  • Induction of protein expression using IPTG at optimized concentrations and temperatures

For membrane proteins like HtpX, expressing the protein with a histidine tag has proven effective, as demonstrated with other H. parasuis membrane proteins that were successfully expressed in E. coli systems .

What purification challenges are specific to HtpX as a membrane metalloprotease?

Purifying HtpX presents several challenges due to its nature as a membrane metalloprotease:

  • Protein solubility: As an integral membrane protein, HtpX contains hydrophobic domains that can lead to aggregation and inclusion body formation. Optimizing expression conditions including lower temperatures (16-25°C) and reduced IPTG concentrations may improve solubility.

  • Preservation of structural integrity: The metalloprotease activity depends on the zinc-binding motif, which must be properly maintained during purification. Including zinc or other divalent cations in purification buffers may help preserve the active site.

  • Detergent selection: Appropriate detergents must be used to solubilize the membrane protein while maintaining its native conformation. A screening approach with detergents like DDM, LDAO, or Triton X-100 at varying concentrations is recommended.

  • Purification strategy: Ni²⁺-NTA affinity chromatography has proven effective for His-tagged recombinant proteins from H. parasuis, as demonstrated with other OMPs . This should be followed by additional purification steps such as ion exchange or size exclusion chromatography.

How can researchers verify the expression and identity of recombinant HtpX?

Verification of expression and identity of recombinant HtpX should follow a multi-step approach:

  • SDS-PAGE analysis: Purified recombinant HtpX should be analyzed by SDS-PAGE to confirm the expected molecular weight. For example, the HtpX of B. subtilis is approximately 298 amino acids , and the H. parasuis homolog would likely have a comparable size.

  • Western blotting: Using anti-His antibodies for detection of the His-tagged recombinant protein is essential. Additionally, if available, convalescent sera from H. parasuis-infected pigs can be used to confirm antigenicity, as demonstrated with other H. parasuis recombinant proteins .

  • Mass spectrometry: For definitive identification, tryptic digestion followed by mass spectrometry analysis should be performed to compare peptide fragments with predicted sequences.

  • Enzymatic activity assay: As a metalloprotease, HtpX activity can be assessed using appropriate peptide substrates and monitoring cleavage products.

What approaches can be used to study the heat stress response regulation of htpX in H. parasuis?

To study the heat stress response regulation of htpX in H. parasuis, researchers can implement several approaches:

  • Quantitative RT-PCR: Monitor htpX expression levels under different temperature conditions (normal growth vs. heat shock) to determine heat inducibility.

  • Promoter fusion studies: Create transcriptional fusions between the htpX promoter region and reporter genes (such as lacZ or gfp) to analyze promoter activity under various conditions.

  • Site-directed mutagenesis: Introduce specific mutations in potential regulatory regions (e.g., -10 box of σA promoter) similar to the approach used in B. subtilis studies to identify critical regulatory elements.

  • Electrophoretic mobility shift assays (EMSA): Identify potential regulators binding to the htpX promoter region by examining protein-DNA interactions.

  • Chromatin immunoprecipitation (ChIP): Determine if regulators similar to Rok or YkrK in B. subtilis bind to the htpX promoter in vivo.

How does HtpX interact with other bacterial stress response systems during infection?

HtpX likely interfaces with other stress response systems through complex regulatory networks:

  • Interaction with FtsH: Studies in B. subtilis suggest potential functional relationships between HtpX and FtsH, another membrane protease . Researchers investigating H. parasuis should consider generating and analyzing ftsH htpX double mutants to elucidate potential compensatory or synergistic functions.

  • Heat shock response coordination: As a heat-inducible gene, htpX expression may be coordinated with other heat shock proteins through shared regulatory elements or mechanisms.

  • Envelope stress response: HtpX may participate in broader envelope stress response pathways that are critical during host-pathogen interactions.

  • Oxidative stress cross-talk: Membrane integrity maintained by HtpX function might indirectly influence resistance to oxidative stress encountered within host cells.

What is the immunogenic potential of recombinant HtpX in comparison to other H. parasuis outer membrane proteins?

The immunogenic potential of recombinant HtpX should be evaluated systematically in comparison to other H. parasuis outer membrane proteins (OMPs):

  • Antibody response: While specific data on HtpX immunogenicity is not directly available in the search results, other H. parasuis OMPs such as TolC, LppC, and HAPS_0926 have demonstrated high-titer antibody responses in mouse models . Similar immunization protocols should be applied to recombinant HtpX for comparative analysis.

  • T-cell mediated immunity: Assessment of both CD4+ and CD8+ T cell proliferation in response to HtpX stimulation should be conducted, as cellular immunity plays a crucial role in protection against bacterial infections. The methodology used for other OMPs, including flow cytometry analysis (as shown in Fig. 4 of the first search result), can be applied to HtpX .

  • Cytokine profiles: Measurement of IL-2, IL-4, and IFN-γ levels in response to HtpX immunization would provide insights into the type of immune response elicited (Th1 vs. Th2) .

What methodology should be used to evaluate HtpX as a potential vaccine candidate against H. parasuis infection?

A comprehensive evaluation of HtpX as a vaccine candidate should follow this methodological framework:

  • Animal immunization protocol:

    • Use a murine model with appropriate control groups

    • Administer purified recombinant HtpX (typically 100 μg per dose) with a suitable adjuvant

    • Follow a prime-boost strategy with 2-3 immunizations at 2-week intervals

    • Collect sera for antibody titer determination

  • Immune response evaluation:

    • Measure specific antibody titers by ELISA

    • Assess lymphocyte proliferation using MTS cell proliferation assay

    • Determine cytokine profiles (IL-2, IL-4, IFN-γ)

    • Analyze CD4+ and CD8+ T cell populations by flow cytometry

  • Protection studies:

    • Challenge immunized animals with virulent H. parasuis

    • Monitor survival rates and clinical signs

    • Measure bacterial loads in tissues (spleen, liver, lung) by bacterial counting

    • Perform PCR confirmation of recovered bacteria

  • Bactericidal activity assessment:

    • Conduct whole blood bactericidal assays using immune sera

    • Calculate bactericidal indices compared to control sera

  • Potential for combined vaccines:

    • Evaluate HtpX in combination with other protective antigens, as combining multiple antigens has shown enhanced protection against H. parasuis (as demonstrated with other OMPs)

Evaluation ParameterMethodologyExpected Outcome for Effective Vaccine Candidate
Antibody titersELISAHigh specific IgG titers (>10,000)
Lymphocyte proliferationMTS assayStimulation index >2.0 compared to controls
CD4+/CD8+ T cellsFlow cytometrySignificant increase in both populations
Cytokine productionELISABalanced Th1/Th2 response (IL-2, IFN-γ, IL-4)
Bacterial clearanceTissue bacterial load>2 log reduction compared to controls
Survival rateChallenge study>70% survival after lethal challenge
Bactericidal activityWhole blood assay>50% reduction in bacterial counts

How can gene knockout studies be designed to assess the functional significance of HtpX in H. parasuis?

To design effective gene knockout studies for htpX in H. parasuis, researchers should consider the following methodological approach:

  • Knockout strategy:

    • Use a two-step gene replacement method similar to that described for B. subtilis

    • Replace the htpX gene with an antibiotic resistance marker (e.g., kanamycin resistance gene)

    • Verify replacement by PCR and sequencing

  • Construction of complementation strains:

    • Create plasmid vectors containing the intact htpX gene

    • Reintroduce the gene into the knockout strain to confirm phenotype reversal

  • Phenotypic characterization:

    • Growth kinetics under normal and stress conditions (temperature, pH, oxidative stress)

    • Membrane integrity assessment

    • Proteomic analysis to identify accumulated substrates in the absence of HtpX

    • Transcriptomic analysis to identify compensatory mechanisms

  • Creation of double/multiple mutants:

    • Generate double mutants with related proteases (e.g., ftsH htpX) to assess functional redundancy

    • Create mutations in potential regulatory genes to understand control mechanisms

  • In vivo virulence assessment:

    • Compare colonization and disease progression between wild-type and htpX mutant strains

    • Evaluate immune response to infection with mutant strains

What are the challenges in resolving the three-dimensional structure of membrane-bound HtpX and how might these be overcome?

Determining the three-dimensional structure of membrane-bound HtpX presents significant challenges that require specialized approaches:

  • Challenges in structural determination:

    • Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces

    • Obtaining sufficient quantities of properly folded protein can be problematic

    • Detergent micelles necessary for solubilization can interfere with crystal formation

    • Membrane proteins often have flexible regions that complicate structure determination

  • Potential solutions and methodologies:

    • Protein engineering: Create fusion proteins or truncated versions retaining catalytic domains

    • Crystallization techniques:

      • Lipidic cubic phase crystallization specifically designed for membrane proteins

      • Use of antibody fragments to stabilize certain conformations

      • Nanodiscs or amphipols as alternatives to detergent micelles

    • Alternative structural methods:

      • Cryo-electron microscopy (cryo-EM) which has revolutionized membrane protein structure determination

      • Nuclear magnetic resonance (NMR) for smaller domains or fragments

      • Cross-linking mass spectrometry to determine spatial relationships between domains

  • Computational approaches:

    • Homology modeling based on related proteases with known structures

    • Molecular dynamics simulations to understand membrane interactions and substrate binding

    • Integration of experimental data with computational predictions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.