This 11.1 kDa protein (full-length, 99 amino acids) is encoded by an open reading frame (ORF10) located in the rep-hol intergenic region of the HP1 phage genome. While its specific biological function remains unknown, its genomic placement suggests potential roles in phage replication or regulation .
| Parameter | Specification |
|---|---|
| Species | Haemophilus phage HP1 |
| Source | Expressed in E. coli (recombinant production) |
| Tag | N-terminal His-tag |
| Purity | >90% (SDS-PAGE validated) |
| Form | Lyophilized powder (Tris/PBS buffer, 6% trehalose, pH 8.0) |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL); 50% glycerol recommended for storage |
The protein’s sequence is:
MNKRKQKQISRILAAKRAEKCGQINAELQETGEYLEGRVHLLRAKLSINGINLKAYVLEQ VINIKHQIVTERFGNVLLGLASGMIGGIIGMFMWVLCIL .
Host: E. coli (induced expression system).
Yield: Commercially available in quantities up to 50 µg (custom sizes available) .
Purification: Affinity chromatography (His-tag) followed by lyophilization .
| Protein | Function | Genomic Location |
|---|---|---|
| HP1 Integrase | Site-specific recombination (integration) | Early transcriptional unit |
| HP1 Cox | Regulator of excisive recombination | Early transcriptional unit |
| HP1 Holin (Lysis) | Pinholin for host cell lysis | Late transcriptional unit |
| 11.1 kDa Protein | Uncharacterized (rep-hol intergenic region) | Intergenic region (rep-hol) |
Structural Studies: Crystallization or NMR analysis to elucidate tertiary structure.
Functional Screens: Testing interactions with HP1 integrase, Cox, or host tRNA genes .
Lytic Cycle Research: Investigating roles in replication or prophage stability.
KEGG: vg:1261134
The Haemophilus Phage HP1 Uncharacterized 11.1 kDa protein (UniProt ID: P51712) is a small viral protein located in the intergenic region between the replication (rep) and holin (hol) genes of Haemophilus phage HP1. It is also known as ORF10 and consists of 99 amino acids with a molecular weight of approximately 11.1 kDa. The protein has not been fully characterized in terms of its biological function, but its location in an intergenic region suggests potential regulatory roles in viral replication or host interaction mechanisms. The commercially available recombinant form is typically produced with an N-terminal His-tag in E. coli expression systems .
The recombinant Haemophilus Phage HP1 Uncharacterized 11.1 kDa protein should be stored at -20°C to -80°C for long-term preservation. To maintain protein integrity, consider the following handling protocol:
Upon receipt, briefly centrifuge the vial to bring contents to the bottom
Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 50% for cryoprotection
Prepare small single-use aliquots to avoid repeated freeze-thaw cycles
Store working aliquots at 4°C for up to one week
For storage buffer, use Tris/PBS-based buffer with 6% Trehalose at pH 8.0
Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. Research has demonstrated that proteins in this family can lose up to 30% of their activity with each freeze-thaw cycle, particularly when stored at concentrations below 0.1 mg/mL.
When designing experiments with this intergenic protein, researchers should consider the following specialized approaches:
Regulatory context analysis: Since the protein originates from an intergenic region, examine potential interactions with neighboring genes (rep and hol). Mammalian intergenic regions are known to contain numerous cis-regulatory elements that affect gene expression in tissue-specific manners .
Enhancer activity assessment: Design experiments to test whether this protein interacts with or regulates enhancers. Extended intergenic regions have been shown to contain approximately twice as many active enhancers in neural tissues compared to other tissues .
Co-expression studies: Investigate if the protein is co-expressed with neighboring genes. Neural genes with extended intergenic regions are often globally co-expressed with neighboring neural genes controlled by distinct enhancers in shared intergenic regions .
Chromatin interaction analysis: Consider chromatin immunoprecipitation (ChIP) experiments to identify potential interactions with chromatin-associated proteins like Heterochromatin Protein 1 (HP1), which has been shown to associate with chromosomes through interactions with both histone and non-histone chromosomal proteins .
This experimental design consideration is crucial because intergenic proteins often have context-dependent functions that may not be apparent in isolated protein studies.
Given the location of this protein in an intergenic region, and the known association of such regions with chromatin regulation, the following methodological approaches are recommended:
Chromatin Immunoprecipitation (ChIP) assays: Use anti-His antibodies to pull down the recombinant protein and identify associated DNA sequences. This technique can help determine if the protein binds to specific genomic regions.
Protein-protein interaction studies: Perform co-immunoprecipitation experiments to identify interactions with chromatin-associated proteins, particularly focusing on:
Heterochromatin Protein 1 (HP1) family proteins, which interact with chromosomes through both histone and non-histone mechanisms
Chromatin Assembly Factor 1 (CAF1), which associates with HP1 during DNA replication
Origin Recognition Complex (ORC) proteins, which associate with HP1 in high molecular weight complexes
Domain-based functional analysis: The chromo domain (CD) and chromo shadow domain (CSD) of HP1 proteins have distinct roles in chromatin binding and protein interactions. Testing for interactions with these domains can provide insights into the function of the intergenic protein .
Histone modification assays: Investigate if the protein affects histone modifications, particularly H3K9 methylation, which is recognized by the chromo domain of HP1 proteins .
These approaches should be conducted with appropriate controls, including using other intergenic proteins as comparative references to distinguish specific from non-specific effects.
Differentiating between direct and indirect effects of this uncharacterized protein requires a multi-faceted approach:
Time-course experiments: Monitor changes in target systems at short intervals (minutes to hours) after protein introduction. Direct effects typically occur more rapidly than indirect effects.
Dose-response studies: Establish quantitative relationships between protein concentration and observed effects. Direct interactions often show predictable dose-response curves. Use the following concentration range as a starting point:
| Concentration (μg/mL) | Typical Application | Expected Response Time |
|---|---|---|
| 0.1-1.0 | Binding assays | Minutes to hours |
| 1.0-5.0 | Functional studies | Hours |
| 5.0-10.0 | Structural analyses | N/A |
In vitro reconstitution: Attempt to recreate observed effects using purified components in a cell-free system. This approach can help eliminate cellular factors that might mediate indirect effects.
Domain mutation analysis: Introduce specific mutations to functional domains predicted by sequence analysis and test how these affect protein activity. For instance, altering the basic N-terminal region might affect DNA binding capabilities.
Crosslinking studies: Use chemical crosslinking followed by mass spectrometry to identify direct binding partners with high confidence.
When publishing results, clearly distinguish between confirmed direct interactions and correlative observations that may involve intermediate factors.
Rigorous quality control is essential when working with recombinant proteins to prevent experimental artifacts similar to those described in cytokine research . Implement the following comprehensive protocol:
Multi-method purity assessment:
SDS-PAGE with silver staining (detection limit ~1 ng protein)
Western blot using antibodies against both the target protein and common contaminants
Mass spectrometry to identify potential contaminant proteins
Endotoxin testing using LAL assay (limit <0.1 EU/μg protein)
Biological activity verification:
Compare activity across multiple protein lots
Test proteins from different suppliers when possible
Include appropriate negative controls in all experiments
Reproducibility measures:
Document protein lot numbers used in experiments
Establish internal reference standards for comparison
Create detailed SOPs for protein handling and storage
Contaminant-specific controls:
Include anti-His tag controls to detect expression system artifacts
Test for E. coli-derived proteins that commonly contaminate recombinant preparations
Screen for activity attributable to common contaminants like lipopolysaccharides
To ensure the recombinant protein maintains its structural integrity after reconstitution, employ these validation techniques:
Circular Dichroism (CD) Spectroscopy:
Near-UV CD (250-350 nm) to assess tertiary structure
Far-UV CD (190-250 nm) to determine secondary structure composition
Compare spectra with theoretical predictions based on amino acid sequence
Thermal Stability Assessment:
Differential Scanning Calorimetry (DSC) to determine melting temperature (Tm)
Thermal shift assays using fluorescent dyes to monitor unfolding
Establish baseline stability parameters for future reference
Size Exclusion Chromatography (SEC):
Monitor for aggregation or degradation products
Compare elution profiles before and after storage periods
Quantify monomer percentage (should typically exceed 95%)
Functional Binding Assays:
Develop a specific activity assay based on predicted protein function
Measure binding kinetics to potential interaction partners
Compare activity metrics with freshly prepared standards
The following table provides guidance on expected structural integrity parameters:
| Parameter | Acceptable Range | Warning Signs |
|---|---|---|
| Monomer content | >95% | <90% indicates significant aggregation |
| Secondary structure deviation | <10% from reference | >15% suggests partial unfolding |
| Thermal stability (Tm) | Within ±2°C of reference | Reduction >5°C indicates destabilization |
| Specific activity | >80% of reference | <70% suggests functional impairment |
Document all validation results and maintain a quality control database for inter-lot comparison and experimental reproducibility.
Based on current understanding of intergenic regulatory mechanisms, this uncharacterized protein may function through several sophisticated mechanisms:
Enhancer-Promoter Interaction Regulation: The protein might facilitate or inhibit chromatin looping that brings enhancers and promoters into proximity. Extended intergenic regions contain numerous cis-regulatory elements that affect gene expression patterns . The protein's potential interaction with HP1 family proteins, which participate in chromatin packaging and gene silencing, could modulate these interactions .
Chromatin Boundary Element Function: The protein may act as part of a boundary complex that separates different chromatin domains. HP1, which interacts with both methylated histone H3 and non-histone chromosomal proteins, plays critical roles in establishing such boundaries .
Transcriptional Regulation Through Protein Complexes: The protein might participate in multi-protein regulatory complexes. HP1 functions as an adaptor, bringing together different proteins via interactions with its chromo and shadow domains . The protein could interact with the shadow domain of HP1, which recognizes PXVXL motif peptides .
Phase Separation Mediation: Recent research suggests that heterochromatin formation involves liquid-liquid phase separation, with HP1 proteins as key drivers. This intergenic protein might modulate phase separation properties of chromatin, thereby influencing gene expression patterns.
DNA Replication Timing Regulation: Given that HP1 associates with Origin Recognition Complex (ORC) proteins , this intergenic protein might influence DNA replication timing or origin firing through similar interactions.
This theoretical framework provides testable hypotheses for experimental investigation of this uncharacterized protein's function within the intergenic regulatory landscape.
Several cutting-edge techniques can elucidate this protein's role in phage biology and enable synthetic biology applications:
CRISPR-Cas9 Genetic Manipulation:
Create precise deletions or mutations in the native gene within the phage genome
Assess effects on phage replication kinetics, host range, and packaging efficiency
Engineer compensatory mutations in interacting proteins to validate functional relationships
Single-Molecule Biophysics:
Employ Förster Resonance Energy Transfer (FRET) to detect protein-protein or protein-DNA interactions at the single-molecule level
Use Atomic Force Microscopy (AFM) to visualize structural changes in DNA upon protein binding
Apply magnetic tweezers to measure DNA condensation or looping facilitated by the protein
Phage Display Technology:
Engineer the protein as a display scaffold for peptide libraries
Screen for binding partners that might indicate native function
Develop synthetic variants with enhanced binding or catalytic properties
Cryo-Electron Microscopy:
Determine high-resolution structure of the protein alone and in complex with interaction partners
Visualize the protein's location within the assembled phage particle
Identify structural changes upon binding to target molecules
Synthetic Biology Applications:
Design artificial genetic circuits incorporating the protein as a regulatory module
Engineer chimeric proteins combining functional domains for novel applications
Develop phage-based biocontrol strategies targeting Haemophilus species
These approaches not only address fundamental questions about phage biology but also explore the potential for repurposing this protein in synthetic biology applications such as targeted gene delivery, biocontrol systems, or molecular diagnostics.
Researchers frequently encounter solubility and stability challenges with this recombinant protein. The following systematic approaches can resolve these issues:
Optimizing Buffer Conditions:
The protein's solubility is highly sensitive to buffer composition. Systematically test the following parameters:
| Buffer Component | Optimization Range | Recommended Starting Point |
|---|---|---|
| pH | 6.0-9.0 | 8.0 (Tris/PBS-based) |
| Salt (NaCl) | 50-500 mM | 150 mM |
| Reducing agents | 0-5 mM DTT or 0-1 mM TCEP | 1 mM DTT |
| Stabilizers | 5-10% glycerol, 1-10 mM MgCl₂ | 6% Trehalose |
| Detergents | 0.01-0.1% non-ionic detergents | 0.01% Tween-20 |
Temperature-Dependent Solubility Profiling:
Perform thermal stability assays between 4°C and 37°C
Identify the temperature range that maximizes solubility while maintaining functionality
Consider working at lower temperatures (4-10°C) for proteins prone to aggregation
Protein Engineering Approaches:
Consider alternative tag positions (C-terminal vs. N-terminal)
Test different affinity tags (His, GST, MBP) that can enhance solubility
Explore fusion partners known to improve soluble expression
Co-expression with Chaperones:
Co-express with folding chaperones (GroEL/GroES, DnaK/DnaJ)
Add chemical chaperones to buffer systems (e.g., arginine, proline)
Consider protein disulfide isomerases for proteins with disulfide bonds
Advanced Refolding Strategies:
Implement step-wise dialysis protocols for proteins recovered from inclusion bodies
Utilize on-column refolding during purification
Test pulsed dilution techniques to minimize aggregation during refolding
Remember to document all optimization steps and create a detailed protocol for future reference, as subtle changes in handling can significantly impact protein behavior.
Distinguishing between experimental artifacts and genuine biological effects is critical when working with uncharacterized proteins. Implement this comprehensive validation framework:
Independent Methodological Validation:
Confirm observations using at least three independent experimental approaches
For interaction studies, employ both in vitro (pull-down) and in vivo (co-IP) methods
Validate functional effects using both gain-of-function and loss-of-function approaches
Rigorous Controls:
Include structurally similar but functionally distinct proteins as negative controls
Use mutated versions of the protein targeting predicted functional domains
Employ scrambled peptides or heat-inactivated proteins as specificity controls
Titration Studies:
Establish clear dose-response relationships for all observed effects
Determine EC50/IC50 values for activities and compare with known biological mediators
Verify that effects occur at physiologically relevant concentrations
Cross-Validation With Multiple Protein Sources:
Compare results using proteins from different suppliers or production batches
Express and purify the protein using alternative systems (bacterial, insect, mammalian)
Test native protein isolated from phage particles alongside recombinant versions
Elimination of Contaminant Effects:
Perform parallel experiments with highly purified subfractions
Use specific inhibitors or blocking antibodies to rule out effects from common contaminants
Include mock purifications from expression systems lacking the target gene