Recombinant Haemophilus phage HP1 Uncharacterized 11.1 kDa protein in rep-hol intergenic region

Shipped with Ice Packs
In Stock

Description

Protein Overview

This 11.1 kDa protein (full-length, 99 amino acids) is encoded by an open reading frame (ORF10) located in the rep-hol intergenic region of the HP1 phage genome. While its specific biological function remains unknown, its genomic placement suggests potential roles in phage replication or regulation .

ParameterSpecification
SpeciesHaemophilus phage HP1
SourceExpressed in E. coli (recombinant production)
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
FormLyophilized powder (Tris/PBS buffer, 6% trehalose, pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); 50% glycerol recommended for storage

Amino Acid Sequence

The protein’s sequence is:
MNKRKQKQISRILAAKRAEKCGQINAELQETGEYLEGRVHLLRAKLSINGINLKAYVLEQ VINIKHQIVTERFGNVLLGLASGMIGGIIGMFMWVLCIL .

Expression and Yield

  • Host: E. coli (induced expression system).

  • Yield: Commercially available in quantities up to 50 µg (custom sizes available) .

  • Purification: Affinity chromatography (His-tag) followed by lyophilization .

Comparison with Related Phage Proteins

ProteinFunctionGenomic Location
HP1 IntegraseSite-specific recombination (integration)Early transcriptional unit
HP1 CoxRegulator of excisive recombinationEarly transcriptional unit
HP1 Holin (Lysis)Pinholin for host cell lysisLate transcriptional unit
11.1 kDa ProteinUncharacterized (rep-hol intergenic region)Intergenic region (rep-hol)

Potential Use Cases

  • Structural Studies: Crystallization or NMR analysis to elucidate tertiary structure.

  • Functional Screens: Testing interactions with HP1 integrase, Cox, or host tRNA genes .

  • Lytic Cycle Research: Investigating roles in replication or prophage stability.

Knowledge Gaps

  • Functional Data: No experimental evidence links this protein to specific biochemical activities (e.g., nuclease, DNA-binding) .

  • Pathway Involvement: No reported interactions with host or phage proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Avoid repeated freezing and thawing. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
In general, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing your requested tag.
Synonyms
Uncharacterized 11.1 kDa protein in rep-hol intergenic region; ORF10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Haemophilus phage HP1 (strain HP1c1) (Bacteriophage HP1)
Target Protein Sequence
MNKRKQKQISRILAAKRAEKCGQINAELQETGEYLEGRVHLLRAKLSINGINLKAYVLEQ VINIKHQIVTERFGNVLLGLASGMIGGIIGMFMWVLCIL
Uniprot No.

Target Background

Database Links

KEGG: vg:1261134

Subcellular Location
Host membrane; Single-pass membrane protein.

Q&A

What is the Haemophilus Phage HP1 Uncharacterized 11.1 kDa protein in rep-hol intergenic region?

The Haemophilus Phage HP1 Uncharacterized 11.1 kDa protein (UniProt ID: P51712) is a small viral protein located in the intergenic region between the replication (rep) and holin (hol) genes of Haemophilus phage HP1. It is also known as ORF10 and consists of 99 amino acids with a molecular weight of approximately 11.1 kDa. The protein has not been fully characterized in terms of its biological function, but its location in an intergenic region suggests potential regulatory roles in viral replication or host interaction mechanisms. The commercially available recombinant form is typically produced with an N-terminal His-tag in E. coli expression systems .

What are the optimal storage and handling conditions for the recombinant protein?

The recombinant Haemophilus Phage HP1 Uncharacterized 11.1 kDa protein should be stored at -20°C to -80°C for long-term preservation. To maintain protein integrity, consider the following handling protocol:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for cryoprotection

  • Prepare small single-use aliquots to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For storage buffer, use Tris/PBS-based buffer with 6% Trehalose at pH 8.0

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. Research has demonstrated that proteins in this family can lose up to 30% of their activity with each freeze-thaw cycle, particularly when stored at concentrations below 0.1 mg/mL.

How can the intergenic origin of this protein influence experimental design?

When designing experiments with this intergenic protein, researchers should consider the following specialized approaches:

  • Regulatory context analysis: Since the protein originates from an intergenic region, examine potential interactions with neighboring genes (rep and hol). Mammalian intergenic regions are known to contain numerous cis-regulatory elements that affect gene expression in tissue-specific manners .

  • Enhancer activity assessment: Design experiments to test whether this protein interacts with or regulates enhancers. Extended intergenic regions have been shown to contain approximately twice as many active enhancers in neural tissues compared to other tissues .

  • Co-expression studies: Investigate if the protein is co-expressed with neighboring genes. Neural genes with extended intergenic regions are often globally co-expressed with neighboring neural genes controlled by distinct enhancers in shared intergenic regions .

  • Chromatin interaction analysis: Consider chromatin immunoprecipitation (ChIP) experiments to identify potential interactions with chromatin-associated proteins like Heterochromatin Protein 1 (HP1), which has been shown to associate with chromosomes through interactions with both histone and non-histone chromosomal proteins .

This experimental design consideration is crucial because intergenic proteins often have context-dependent functions that may not be apparent in isolated protein studies.

What are the recommended approaches for investigating potential chromatin-related functions of this protein?

Given the location of this protein in an intergenic region, and the known association of such regions with chromatin regulation, the following methodological approaches are recommended:

  • Chromatin Immunoprecipitation (ChIP) assays: Use anti-His antibodies to pull down the recombinant protein and identify associated DNA sequences. This technique can help determine if the protein binds to specific genomic regions.

  • Protein-protein interaction studies: Perform co-immunoprecipitation experiments to identify interactions with chromatin-associated proteins, particularly focusing on:

    • Heterochromatin Protein 1 (HP1) family proteins, which interact with chromosomes through both histone and non-histone mechanisms

    • Chromatin Assembly Factor 1 (CAF1), which associates with HP1 during DNA replication

    • Origin Recognition Complex (ORC) proteins, which associate with HP1 in high molecular weight complexes

  • Domain-based functional analysis: The chromo domain (CD) and chromo shadow domain (CSD) of HP1 proteins have distinct roles in chromatin binding and protein interactions. Testing for interactions with these domains can provide insights into the function of the intergenic protein .

  • Histone modification assays: Investigate if the protein affects histone modifications, particularly H3K9 methylation, which is recognized by the chromo domain of HP1 proteins .

These approaches should be conducted with appropriate controls, including using other intergenic proteins as comparative references to distinguish specific from non-specific effects.

How can researchers differentiate between direct and indirect effects when studying this uncharacterized protein?

Differentiating between direct and indirect effects of this uncharacterized protein requires a multi-faceted approach:

  • Time-course experiments: Monitor changes in target systems at short intervals (minutes to hours) after protein introduction. Direct effects typically occur more rapidly than indirect effects.

  • Dose-response studies: Establish quantitative relationships between protein concentration and observed effects. Direct interactions often show predictable dose-response curves. Use the following concentration range as a starting point:

Concentration (μg/mL)Typical ApplicationExpected Response Time
0.1-1.0Binding assaysMinutes to hours
1.0-5.0Functional studiesHours
5.0-10.0Structural analysesN/A
  • In vitro reconstitution: Attempt to recreate observed effects using purified components in a cell-free system. This approach can help eliminate cellular factors that might mediate indirect effects.

  • Domain mutation analysis: Introduce specific mutations to functional domains predicted by sequence analysis and test how these affect protein activity. For instance, altering the basic N-terminal region might affect DNA binding capabilities.

  • Crosslinking studies: Use chemical crosslinking followed by mass spectrometry to identify direct binding partners with high confidence.

When publishing results, clearly distinguish between confirmed direct interactions and correlative observations that may involve intermediate factors.

What quality control measures should be implemented to avoid contamination-related experimental artifacts?

Rigorous quality control is essential when working with recombinant proteins to prevent experimental artifacts similar to those described in cytokine research . Implement the following comprehensive protocol:

  • Multi-method purity assessment:

    • SDS-PAGE with silver staining (detection limit ~1 ng protein)

    • Western blot using antibodies against both the target protein and common contaminants

    • Mass spectrometry to identify potential contaminant proteins

    • Endotoxin testing using LAL assay (limit <0.1 EU/μg protein)

  • Biological activity verification:

    • Compare activity across multiple protein lots

    • Test proteins from different suppliers when possible

    • Include appropriate negative controls in all experiments

  • Reproducibility measures:

    • Document protein lot numbers used in experiments

    • Establish internal reference standards for comparison

    • Create detailed SOPs for protein handling and storage

  • Contaminant-specific controls:

    • Include anti-His tag controls to detect expression system artifacts

    • Test for E. coli-derived proteins that commonly contaminate recombinant preparations

    • Screen for activity attributable to common contaminants like lipopolysaccharides

How can researchers validate the structural integrity of the recombinant protein after reconstitution?

To ensure the recombinant protein maintains its structural integrity after reconstitution, employ these validation techniques:

  • Circular Dichroism (CD) Spectroscopy:

    • Near-UV CD (250-350 nm) to assess tertiary structure

    • Far-UV CD (190-250 nm) to determine secondary structure composition

    • Compare spectra with theoretical predictions based on amino acid sequence

  • Thermal Stability Assessment:

    • Differential Scanning Calorimetry (DSC) to determine melting temperature (Tm)

    • Thermal shift assays using fluorescent dyes to monitor unfolding

    • Establish baseline stability parameters for future reference

  • Size Exclusion Chromatography (SEC):

    • Monitor for aggregation or degradation products

    • Compare elution profiles before and after storage periods

    • Quantify monomer percentage (should typically exceed 95%)

  • Functional Binding Assays:

    • Develop a specific activity assay based on predicted protein function

    • Measure binding kinetics to potential interaction partners

    • Compare activity metrics with freshly prepared standards

The following table provides guidance on expected structural integrity parameters:

ParameterAcceptable RangeWarning Signs
Monomer content>95%<90% indicates significant aggregation
Secondary structure deviation<10% from reference>15% suggests partial unfolding
Thermal stability (Tm)Within ±2°C of referenceReduction >5°C indicates destabilization
Specific activity>80% of reference<70% suggests functional impairment

Document all validation results and maintain a quality control database for inter-lot comparison and experimental reproducibility.

How might this protein function in intergenic regulation, based on current understanding of similar systems?

Based on current understanding of intergenic regulatory mechanisms, this uncharacterized protein may function through several sophisticated mechanisms:

  • Enhancer-Promoter Interaction Regulation: The protein might facilitate or inhibit chromatin looping that brings enhancers and promoters into proximity. Extended intergenic regions contain numerous cis-regulatory elements that affect gene expression patterns . The protein's potential interaction with HP1 family proteins, which participate in chromatin packaging and gene silencing, could modulate these interactions .

  • Chromatin Boundary Element Function: The protein may act as part of a boundary complex that separates different chromatin domains. HP1, which interacts with both methylated histone H3 and non-histone chromosomal proteins, plays critical roles in establishing such boundaries .

  • Transcriptional Regulation Through Protein Complexes: The protein might participate in multi-protein regulatory complexes. HP1 functions as an adaptor, bringing together different proteins via interactions with its chromo and shadow domains . The protein could interact with the shadow domain of HP1, which recognizes PXVXL motif peptides .

  • Phase Separation Mediation: Recent research suggests that heterochromatin formation involves liquid-liquid phase separation, with HP1 proteins as key drivers. This intergenic protein might modulate phase separation properties of chromatin, thereby influencing gene expression patterns.

  • DNA Replication Timing Regulation: Given that HP1 associates with Origin Recognition Complex (ORC) proteins , this intergenic protein might influence DNA replication timing or origin firing through similar interactions.

This theoretical framework provides testable hypotheses for experimental investigation of this uncharacterized protein's function within the intergenic regulatory landscape.

What advanced techniques could reveal the protein's role in phage biology and potential applications in synthetic biology?

Several cutting-edge techniques can elucidate this protein's role in phage biology and enable synthetic biology applications:

  • CRISPR-Cas9 Genetic Manipulation:

    • Create precise deletions or mutations in the native gene within the phage genome

    • Assess effects on phage replication kinetics, host range, and packaging efficiency

    • Engineer compensatory mutations in interacting proteins to validate functional relationships

  • Single-Molecule Biophysics:

    • Employ Förster Resonance Energy Transfer (FRET) to detect protein-protein or protein-DNA interactions at the single-molecule level

    • Use Atomic Force Microscopy (AFM) to visualize structural changes in DNA upon protein binding

    • Apply magnetic tweezers to measure DNA condensation or looping facilitated by the protein

  • Phage Display Technology:

    • Engineer the protein as a display scaffold for peptide libraries

    • Screen for binding partners that might indicate native function

    • Develop synthetic variants with enhanced binding or catalytic properties

  • Cryo-Electron Microscopy:

    • Determine high-resolution structure of the protein alone and in complex with interaction partners

    • Visualize the protein's location within the assembled phage particle

    • Identify structural changes upon binding to target molecules

  • Synthetic Biology Applications:

    • Design artificial genetic circuits incorporating the protein as a regulatory module

    • Engineer chimeric proteins combining functional domains for novel applications

    • Develop phage-based biocontrol strategies targeting Haemophilus species

These approaches not only address fundamental questions about phage biology but also explore the potential for repurposing this protein in synthetic biology applications such as targeted gene delivery, biocontrol systems, or molecular diagnostics.

What strategies can address solubility and stability issues when working with this recombinant protein?

Researchers frequently encounter solubility and stability challenges with this recombinant protein. The following systematic approaches can resolve these issues:

  • Optimizing Buffer Conditions:
    The protein's solubility is highly sensitive to buffer composition. Systematically test the following parameters:

    Buffer ComponentOptimization RangeRecommended Starting Point
    pH6.0-9.08.0 (Tris/PBS-based)
    Salt (NaCl)50-500 mM150 mM
    Reducing agents0-5 mM DTT or 0-1 mM TCEP1 mM DTT
    Stabilizers5-10% glycerol, 1-10 mM MgCl₂6% Trehalose
    Detergents0.01-0.1% non-ionic detergents0.01% Tween-20
  • Temperature-Dependent Solubility Profiling:

    • Perform thermal stability assays between 4°C and 37°C

    • Identify the temperature range that maximizes solubility while maintaining functionality

    • Consider working at lower temperatures (4-10°C) for proteins prone to aggregation

  • Protein Engineering Approaches:

    • Consider alternative tag positions (C-terminal vs. N-terminal)

    • Test different affinity tags (His, GST, MBP) that can enhance solubility

    • Explore fusion partners known to improve soluble expression

  • Co-expression with Chaperones:

    • Co-express with folding chaperones (GroEL/GroES, DnaK/DnaJ)

    • Add chemical chaperones to buffer systems (e.g., arginine, proline)

    • Consider protein disulfide isomerases for proteins with disulfide bonds

  • Advanced Refolding Strategies:

    • Implement step-wise dialysis protocols for proteins recovered from inclusion bodies

    • Utilize on-column refolding during purification

    • Test pulsed dilution techniques to minimize aggregation during refolding

Remember to document all optimization steps and create a detailed protocol for future reference, as subtle changes in handling can significantly impact protein behavior.

How can researchers distinguish between experimental artifacts and genuine biological effects when studying this uncharacterized protein?

Distinguishing between experimental artifacts and genuine biological effects is critical when working with uncharacterized proteins. Implement this comprehensive validation framework:

  • Independent Methodological Validation:

    • Confirm observations using at least three independent experimental approaches

    • For interaction studies, employ both in vitro (pull-down) and in vivo (co-IP) methods

    • Validate functional effects using both gain-of-function and loss-of-function approaches

  • Rigorous Controls:

    • Include structurally similar but functionally distinct proteins as negative controls

    • Use mutated versions of the protein targeting predicted functional domains

    • Employ scrambled peptides or heat-inactivated proteins as specificity controls

  • Titration Studies:

    • Establish clear dose-response relationships for all observed effects

    • Determine EC50/IC50 values for activities and compare with known biological mediators

    • Verify that effects occur at physiologically relevant concentrations

  • Cross-Validation With Multiple Protein Sources:

    • Compare results using proteins from different suppliers or production batches

    • Express and purify the protein using alternative systems (bacterial, insect, mammalian)

    • Test native protein isolated from phage particles alongside recombinant versions

  • Elimination of Contaminant Effects:

    • Perform parallel experiments with highly purified subfractions

    • Use specific inhibitors or blocking antibodies to rule out effects from common contaminants

    • Include mock purifications from expression systems lacking the target gene

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.