Recombinant Haemophilus phage HP1 Uncharacterized 23.2 kDa protein in int-C1 intergenic region

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Uncharacterized 23.2 kDa protein in int-C1 intergenic region; ORF1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Haemophilus phage HP1 (strain HP1c1) (Bacteriophage HP1)
Target Protein Sequence
MKNLFYALKEHWQIYVGLLLGLIIGLLVGVGFTDWKSLVRGLDSKVTDWISSLSTLIIMC FTAVGVMSWKKQKTPDLKSKVAKNIIDFDTHAVLLPSKKFQSIDEIKEYNAIQLKIFWDI EHSLSTLYMFDKSNKQEIDTILGYLLKDINSATSLIEKHARYDEVGRYQLVSLINNGYKN TYPNTTKLFELVVGKSNVVGLNGSS
Uniprot No.

Target Background

Database Links

KEGG: vg:1261143

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the Haemophilus phage HP1 Uncharacterized 23.2 kDa protein and where is it located in the phage genome?

The Haemophilus phage HP1 Uncharacterized 23.2 kDa protein (also known as ORF1 or HP1p02) is encoded within the int-C1 intergenic region of the HP1 bacteriophage genome. It is located at position NC_001697.1 (1698..2315, complement) in the HP1 genome . The protein consists of 205 amino acids with a molecular weight of approximately 23,260 Da . Its genomic position between the integrase gene (int) and the C1 repressor gene suggests it may play a role in regulating the lysogenic-lytic cycle switch or site-specific integration mechanisms .

HP1 is a temperate bacteriophage belonging to the Myoviridae family that infects Haemophilus influenzae. The complete HP1 genome is 32,355 bp long with cohesive termini and encodes 41 probable protein coding segments organized into five plausible transcriptional units .

What are the optimal expression and purification methods for this recombinant protein?

The recombinant Uncharacterized 23.2 kDa protein is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . A standardized methodology includes:

  • Cloning and Expression: The full-length gene (1-205 aa) is cloned into an expression vector with a His-tag fusion and expressed in E. coli .

  • Purification Process:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Additional chromatography steps may be employed to achieve high purity

    • The final product typically achieves greater than 90% purity as determined by SDS-PAGE

  • Post-purification Processing:

    • The protein is often provided as a lyophilized powder

    • Stabilized in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

An optimized protocol might include varying induction conditions, temperature, and expression duration to maximize yield while minimizing the formation of inclusion bodies, which can be problematic with membrane-associated proteins.

How should researchers handle and store this protein for optimal stability?

For optimal stability and activity maintenance, follow these research-validated handling and storage protocols:

  • Long-term Storage:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Addition of 5-50% glycerol (with 50% being the default recommendation) for freezer storage

  • Reconstitution Protocol:

    • Briefly centrifuge product vial before opening

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • Allow complete solubilization before use

  • Working Storage:

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can lead to denaturation and aggregation

  • Quality Control Measures:

    • Periodically verify protein integrity via SDS-PAGE

    • Consider activity assays if function becomes characterized

These conditions are designed to maintain structural integrity and prevent degradation or aggregation that could compromise experimental results .

What experimental approaches can determine the function of this uncharacterized protein?

To elucidate the function of this uncharacterized protein, a multi-dimensional experimental approach is recommended:

  • Genetic Modification Studies:

    • Generate HP1 phage variants with gene knockouts or mutations

    • Compare phenotypes (plaque morphology, lysis kinetics, host range)

    • Complementation studies with wild-type protein to confirm observed effects

  • Protein Localization Analysis:

    • Create fluorescently tagged versions for microscopy

    • Use subcellular fractionation and immunoblotting

    • Employ immunogold electron microscopy for high-resolution localization

  • Interaction Screening:

    • Perform pull-down assays with His-tagged protein

    • Utilize yeast two-hybrid or bacterial two-hybrid systems to identify binding partners

    • Validate interactions with co-immunoprecipitation and ELISA

  • Functional Assays:

    • Test for DNA binding using electrophoretic mobility shift assays

    • Assess membrane interaction via liposome binding or permeabilization assays

    • Examine effects on site-specific integration efficiency

Research on similar HP1 phage proteins has demonstrated the utility of these approaches. For example, studies on the HP1 lytic system characterized the lys and hol gene products using both in silico analysis and molecular cloning , providing a methodological template for investigating this protein.

How can researchers investigate potential protein-protein interactions involving this protein?

Investigating protein-protein interactions for this uncharacterized protein requires a systematic approach combining in vitro and in vivo methods:

  • In Vitro Binding Assays:

    • Pull-down Assays: Immobilize the His-tagged protein on Ni-NTA resin and incubate with H. influenzae lysates or purified phage proteins

    • Surface Plasmon Resonance (SPR): Measure real-time binding kinetics between the protein and potential partners

    • Biolayer Interferometry: Determine association and dissociation rates with candidate interactors

  • In Vivo Interaction Methods:

    • Bacterial Two-Hybrid: Particularly appropriate for bacterial systems to identify interactions in a cellular context

    • Proximity-Based Labeling: Fusion with biotin ligase (BioID) or peroxidase (APEX) to identify proximal proteins

    • FRET/BRET Analysis: Monitor protein interactions using fluorescence or bioluminescence resonance energy transfer

  • Candidate Approach Based on Genomic Context:

    • Test interactions with HP1 integrase and C1 repressor proteins given the intergenic location

    • Examine binding to site-specific DNA sequences from the attachment region

    • Screen for interactions with host factors involved in phage integration

  • Validation Strategies:

    • Mutational analysis to identify critical interaction domains

    • Competition assays with peptides derived from binding regions

    • Co-expression studies to assess effects on function

Given the protein's location in the int-C1 intergenic region, priority should be given to testing interactions with integration machinery components and regulatory proteins controlling the lysogenic-lytic switch .

What structural features might provide insights into this protein's function?

Although the three-dimensional structure of this protein has not been experimentally determined, sequence analysis and predictive modeling offer valuable insights into potential structural features:

  • Transmembrane Domain Prediction:

    • The hydrophobic N-terminal region suggests potential membrane-spanning domains

    • Analysis of the amino acid sequence indicates multiple hydrophobic segments that could form transmembrane helices

  • Secondary Structure Elements:

    • Alpha-helical regions are likely present in the hydrophobic segments

    • The protein may contain a signal-arrest-release (SAR) domain similar to that found in the HP1 endolysin, which would facilitate membrane interaction

  • Structural Homology:

    • ModBase structural models (referenced for UniProt ID P51700) suggest potential structural similarity to other phage proteins

    • Comparison with structures of proteins from related P2-like phages may reveal conserved structural motifs

  • Functional Motif Prediction:

    • The protein could potentially contain DNA-binding motifs, given its location near regulatory regions

    • Alternatively, it might possess domains involved in protein-protein interactions with integration machinery components

These structural predictions should guide experimental approaches such as site-directed mutagenesis of key residues to test hypotheses about function and interaction capabilities.

How might this protein relate to the site-specific integration mechanism of HP1 phage?

Given its location in the int-C1 intergenic region, this protein may play a significant role in the site-specific integration mechanism of HP1 phage:

  • Attachment Site Context:

    • The distance separating the boundaries of the functional HP1 attachment site is 418 bp, and specific DNA segments are critical for substrate activity in site-specific recombination

    • The uncharacterized protein could interact with these DNA sequences or with proteins that bind these regions

  • Integration Regulation:

    • The protein might serve as a regulatory factor controlling the timing or efficiency of integrase activity

    • It could potentially modulate the switch between integration (lysogeny) and excision (lytic cycle)

  • Architectural Function:

    • The protein could function as an architectural factor that helps organize the DNA-protein complex required for integration

    • It might facilitate the proper alignment of phage and bacterial attachment sites

  • Host Factor Interaction:

    • The protein might interact with host factors necessary for efficient integration

    • It could potentially serve as an adapter between phage components and host cellular machinery

Experimental approaches to test these hypotheses could include:

  • DNA binding assays using attachment site DNA sequences

  • In vitro integration assays with and without the purified protein

  • Construction of mutant phages lacking the gene to assess integration efficiency

  • Protein-protein interaction studies with the HP1 integrase

The search results indicate that specific DNA sequences within the attachment region are critical for HP1 integration , suggesting a complex machinery that might involve this uncharacterized protein.

How does this protein compare to similar proteins in related bacteriophages?

Comparative analysis of this uncharacterized protein with similar proteins in related phages provides evolutionary and functional insights:

  • Phage Family Relationships:

    • HP1 belongs to the P2-like phage family, showing strong similarities to coliphages P2 and 186

    • Homology searches should focus first on proteins in similar genomic contexts within this phage family

  • Structural Conservation vs. Sequence Divergence:

    • Even with limited sequence similarity, structural conservation may exist

    • Domain architecture may be preserved while primary sequences diverge

  • Comparative Genomic Context:

    • Analysis of gene order and orientation in related phages can reveal conserved synteny

    • Similar proteins may be found in comparable regulatory regions across different phages

  • Horizontal Gene Transfer Assessment:

    • GC content analysis of the gene region compared to the rest of the genome

    • Codon usage bias examination to identify potential horizontal acquisition

  • Evolutionary Rate Analysis:

    • Comparative analysis of synonymous vs. non-synonymous substitution rates

    • Identification of conserved residues across divergent homologs, suggesting functional importance

A comprehensive study by Willi et al. identified 346 phages grouped in 52 clusters and 18 superclusters among Aggregatibacter and Haemophilus phages, demonstrating substantial diversity but also evolutionary relationships that could inform the function of this protein .

What implications might this protein have for developing phage-based antimicrobials against Haemophilus infections?

Understanding this uncharacterized protein could contribute significantly to phage-based antimicrobial development:

  • Therapeutic Phage Engineering:

    • Modification of this protein might alter phage host range or infection efficiency

    • Engineering conditional expression could create phages with controlled lysis timing

  • Target Identification:

    • If the protein interacts with specific host factors, these interactions could reveal novel antimicrobial targets

    • Blocking these interactions could potentially inhibit bacterial growth or virulence

  • Integration Control:

    • If involved in integration, modifying this protein could create non-integrating phages that remain lytic

    • Such engineered phages would be more suitable for phage therapy applications

  • Delivery System Development:

    • Membrane-interacting domains could be exploited to develop delivery systems for antimicrobial compounds

    • Fusion proteins combining this protein with antimicrobial peptides could enhance targeting

  • Phage Cocktail Optimization:

    • Understanding diversity among similar proteins across Haemophilus phages could inform the design of effective phage cocktails

    • Selection of phages with complementary integration mechanisms could reduce bacterial resistance development

Recent research has highlighted the potential of phages as therapeutic options against Haemophilus infections, with "putative lytic phages, especially phiKZ-like" being noted as promising candidates . Characterizing this protein could contribute to this emerging field by expanding our understanding of phage-host interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.