Recombinant Haemophilus somnus 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Biological Function of 4-Hydroxybenzoate Octaprenyltransferase

4-hydroxybenzoate octaprenyltransferase (ubiA) is a critical enzyme in the ubiquinone (coenzyme Q) biosynthetic pathway. Ubiquinone functions as an essential component of the electron transport chain in cellular respiration and plays a vital role in bacterial energy metabolism. The enzymatic activity of ubiA represents a crucial step in this pathway that cannot be bypassed for successful ubiquinone production.

The ubiquinone biosynthetic pathway begins with chorismate, which is converted to p-hydroxybenzoate (p-HB) by the enzyme chorismate lyase (CL) . This initial step in the pathway has been well-characterized, with chorismate lyase removing the enolpyruvyl group from chorismate to produce p-hydroxybenzoate specifically for the ubiquinone biosynthetic pathway . The kinetic parameters for chorismate lyase have been determined to be kcat=1.7 s⁻¹, Km=29 μM, with a product inhibition parameter (Kp) of 2.1 μM for p-HB .

Following the production of p-hydroxybenzoate, the ubiA enzyme catalyzes the transfer of an octaprenyl (or other polyprenyl) group to p-hydroxybenzoate, which represents a crucial prenylation step in the pathway. This reaction can be represented as:

p-hydroxybenzoate + octaprenyl diphosphate → 3-octaprenyl-4-hydroxybenzoate + pyrophosphate

This prenylation reaction serves as a key step that anchors the aromatic precursor to the membrane, where subsequent modifications occur to complete the ubiquinone molecule. The enzyme functions by binding both p-hydroxybenzoate and the prenyl donor (octaprenyl diphosphate) and facilitating the condensation reaction between them. This membrane-association is critical for the proper functioning of the enzyme and highlights the importance of the enzyme's structural characteristics.

Since ubiquinone is essential for bacterial energy metabolism, the enzymes involved in its biosynthesis, including ubiA, are potential targets for antimicrobial drug development. Inhibition of ubiA could disrupt energy production in pathogenic bacteria, making it a candidate for targeted therapies against bacterial infections, including those caused by Haemophilus somnus.

Haemophilus somnus as a Pathogen

Haemophilus somnus, now reclassified as Histophilus somni, is a gram-negative bacterium and opportunistic pathogen associated with multisystemic diseases in bovines . Understanding the context of this organism is essential for appreciating the significance of studying its enzymes, including ubiA. H. somnus infections can lead to various clinical manifestations in cattle, including respiratory disease, septicemia, thrombotic meningoencephalitis, myocarditis, arthritis, and reproductive failures.

Several virulence factors have been identified in H. somnus, including lipo-oligosaccharide phase variation, induction of apoptosis, intraphagocytic survival, and immunoglobulin Fc binding proteins . These virulence factors contribute to the pathogen's ability to evade host immune responses and cause disease in affected animals. The sophisticated mechanisms employed by this pathogen highlight the importance of understanding its metabolic pathways for developing effective control strategies.

H. somnus is closely related to another pathogen, H. ovis, and it has been proposed that they be assigned to a single species, Histophilus somni . The sequencing of genomes from different strains of H. somnus has facilitated the identification of genes responsible for distinctive attributes within this species and related bacteria . This genomic information has enhanced our understanding of H. somnus virulence factors and facilitates the development of new and improved vaccines against this pathogen.

Iron acquisition is a critical aspect of bacterial pathogenesis, and H. somnus has been found to possess systems for acquiring iron from transferrins (Tfs) . Specifically, H. somnus strain 649 has been shown to acquire iron from ovine, bovine, and goat transferrins. This strain possesses two distinct transferrin receptors: one specific for bovine transferrin and another capable of binding various ruminant transferrins . This sophisticated iron acquisition system highlights the adaptability of H. somnus as a pathogen in its bovine host environment.

While the direct role of ubiA in H. somnus pathogenicity has not been explicitly established in the available research, as a component of the ubiquinone biosynthetic pathway, it is essential for energy metabolism, which is necessary for bacterial growth and survival during infection. Therefore, ubiA indirectly contributes to the pathogen's ability to establish and maintain infection in the host, making it a potential target for therapeutic intervention.

Production and Purification of Recombinant ubiA

The production of recombinant H. somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) involves expression in E. coli systems with an N-terminal histidine tag to facilitate purification . The recombinant protein encompasses the full-length sequence (amino acids 1-286) of the native ubiA protein. This expression system has been optimized to produce high yields of functional protein suitable for various research applications.

The expression in E. coli allows for efficient production of the protein, and the histidine tag enables purification using affinity chromatography techniques. The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE analysis . This high level of purity is essential for reliable results in subsequent biochemical and structural studies.

After purification, the recombinant ubiA protein is typically supplied in lyophilized powder form. For storage, it is recommended to keep the protein at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to avoid repeated freeze-thaw cycles . Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of enzymatic activity.

The storage buffer consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . The inclusion of trehalose in the buffer helps to stabilize the protein during lyophilization and subsequent storage. This formulation has been optimized to maintain protein stability and activity during long-term storage.

For reconstitution, it is recommended to briefly centrifuge the vial prior to opening to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol (5-50% final concentration, with 50% being the default) is recommended for long-term storage at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week without significant loss of activity.

Applications and Research Significance

Recombinant H. somnus 4-hydroxybenzoate octaprenyltransferase (ubiA) has several important applications in research and potential implications for antimicrobial drug development. The availability of purified recombinant protein has facilitated various studies that enhance our understanding of bacterial metabolism and pathogenicity.

Enzymatic Studies

The availability of purified recombinant ubiA enables detailed studies of the enzyme's kinetics, substrate specificity, and reaction mechanisms. Such studies contribute to our understanding of the ubiquinone biosynthetic pathway and prenylation reactions in bacteria. By characterizing the catalytic properties of ubiA, researchers can gain insights into the fundamental biochemical processes that support bacterial survival and growth.

Enzymatic assays using the recombinant protein can determine parameters such as Km, Vmax, and substrate specificity, providing valuable information about the enzyme's function. These studies can also investigate the effects of various conditions, such as pH, temperature, and the presence of inhibitors, on enzyme activity. Such information is crucial for understanding the enzyme's role in bacterial metabolism and for designing potential inhibitors.

Antimicrobial Drug Development

Since ubiquinone is essential for bacterial energy metabolism, the enzymes involved in its biosynthesis, including ubiA, are potential targets for antimicrobial drug development. The availability of recombinant ubiA enables high-throughput screening of compound libraries to identify potential inhibitors that could be developed into novel antibiotics. These inhibitors could potentially disrupt energy production in pathogenic bacteria, including H. somnus, leading to bacterial death or growth inhibition.

The development of selective inhibitors of ubiA could provide new therapeutic options for treating infections caused by H. somnus and related pathogens. Such targeted approaches could potentially overcome issues of antibiotic resistance that are becoming increasingly prevalent in veterinary medicine.

Vaccine Development

Understanding the proteins expressed by H. somnus, including ubiA, contributes to our knowledge of this pathogen and may inform the development of vaccines against H. somnus infections in cattle. The sequencing of H. somnus genomes has facilitated the identification of genes responsible for distinctive attributes within this species and related bacteria, which enhances our understanding of H. somnus virulence factors and facilitates the development of new and improved vaccines .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on your purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it.
Synonyms
ubiA; HSM_0025; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
ubiA
Target Protein Sequence
MTIFAKDKLIAYGQLMRLDKPIGTLLLLWPTLWALYLAEKAMPTLSVLAIFIFGVFLMRS AGCVINDYADRHIDGKVKRTSLRPLSTGRATPREAKWLFIVLVFCSFLLVLCLNLYTIGL SVIAVILAFIYPFMKRYTHLPQFFLGAAFGWSIPMAYGATIEALPLECWLLFIANLSWTV AYDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIIALLQIITLIFLFSVGYLSQLNNRYFI VLAIAGLFFVYQCRLTKNRDRESCFNAFLNNNYFGLTVFIAVLFGI
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: hsm:HSM_0025

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are used to characterize the enzymatic activity of recombinant ubiA protein?

Characterizing the enzymatic activity of recombinant Haemophilus somnus ubiA requires several methodological approaches:

  • Spectrophotometric assays: Monitoring the decrease in 4-hydroxybenzoate concentration or the formation of prenylated products using UV-vis spectroscopy.

  • Radioisotope labeling: Using 14C-labeled substrates to track the transfer of prenyl groups.

  • HPLC analysis: Separating and quantifying reaction products to determine enzyme kinetics.

  • Membrane reconstitution: Since ubiA is a membrane protein, reconstituting it in liposomes or nanodiscs to accurately assess activity in a lipid environment.

  • Coupled enzyme assays: Using auxiliary enzymes to detect product formation when direct measurement is challenging.

The reaction typically requires divalent metal ions (Mg2+ or Mn2+) as cofactors, and activity measurements should include controls to account for substrate degradation and spontaneous reactions.

How does Histophilus somni pathogenicity relate to the ubiA protein?

While direct evidence linking ubiA to Histophilus somni pathogenicity is limited in the search results, contextual analysis suggests several potential relationships:

What are the optimal expression systems for producing recombinant Haemophilus somnus ubiA protein?

Optimal expression systems for recombinant Haemophilus somnus ubiA protein must account for its membrane-bound nature and potential toxicity when overexpressed:

Recommended Expression Systems:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coli C41(DE3) or C43(DE3)Designed for toxic membrane proteinsLower yields than standard strainsUse lower induction temperatures (16-20°C)
E. coli with pBAD vectorTight regulation with arabinose inductionLess total protein than T7 systemsTitrate inducer concentration carefully
Insect cell systemsBetter membrane protein foldingHigher cost, longer timelineConsider for structural studies
Cell-free systemsAvoids toxicity issuesExpensive for scale-upInclude appropriate lipids or detergents

Expression Protocol Considerations:

  • Use fusion tags that enhance solubility (MBP) or detection (His6)

  • Employ detergents (DDM, LDAO) during extraction and purification

  • Consider co-expression with molecular chaperones (GroEL/ES)

  • Optimize codon usage for the expression host

  • Use low inducer concentrations and extended expression times

What purification strategies yield the highest activity for recombinant ubiA protein?

Purifying membrane proteins like ubiA requires specialized approaches to maintain structure and function:

Recommended Purification Protocol:

  • Cell lysis: French press or sonication in buffer containing protease inhibitors and 10% glycerol

  • Membrane isolation: Differential centrifugation (10,000 × g to remove debris, then 100,000 × g to pellet membranes)

  • Solubilization:

    • Primary detergents: n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Solubilize 1-2 hours at 4°C with gentle agitation

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Include 0.05% detergent in all buffers

    • Elute with imidazole gradient (50-500 mM)

  • Size exclusion chromatography:

    • Superdex 200 column

    • Buffer: 25 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 0.03% DDM

  • Storage:

    • Final buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

How can researchers evaluate the structural integrity of purified ubiA protein?

Assessing the structural integrity of purified ubiA is crucial for meaningful functional studies:

Biophysical Characterization Methods:

  • Circular Dichroism (CD) Spectroscopy:

    • Far-UV (190-250 nm): Secondary structure content

    • Near-UV (250-350 nm): Tertiary structure fingerprint

    • Thermal denaturation: Stability assessment

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence

    • Binding of hydrophobic probes (ANS, bis-ANS)

  • Dynamic Light Scattering (DLS):

    • Homogeneity and aggregation state

    • Hydrodynamic radius

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Absolute molecular weight determination

    • Oligomeric state assessment

  • Limited Proteolysis:

    • Properly folded proteins show resistance to proteolytic digestion

    • Time-course analysis by SDS-PAGE

  • Differential Scanning Fluorimetry (DSF):

    • Thermal stability in different buffer conditions

    • Effect of ligands on protein stability

How can site-directed mutagenesis of ubiA inform structure-function relationships?

Site-directed mutagenesis provides powerful insights into the catalytic mechanism and structural requirements of ubiA:

Key Residues for Mutagenesis Analysis:

  • Aspartate-rich motifs: These conserved regions (DxxD) likely coordinate divalent metal ions required for catalysis. Mutation to alanine or asparagine can confirm their role in metal binding.

  • Transmembrane helices: Mutations in predicted transmembrane regions can elucidate substrate binding pockets and protein-lipid interactions.

  • Aromatic residues: Phenylalanine, tyrosine, and tryptophan residues often interact with the aromatic 4-hydroxybenzoate substrate through π-π stacking. Substitution with alanine can identify critical interaction points.

Experimental Design for Mutagenesis Studies:

  • Generate single point mutations using PCR-based methods

  • Express and purify mutant proteins alongside wild-type controls

  • Compare enzyme kinetics parameters (kcat, Km) for each mutant

  • Assess structural changes using biophysical methods

  • Employ molecular dynamics simulations to interpret experimental findings

What is the potential of Haemophilus somnus ubiA as an antimicrobial target?

The essential nature of ubiquinone biosynthesis makes ubiA a potential antimicrobial target, particularly given the rise of antimicrobial resistance in pathogens:

Rationale for ubiA as a Drug Target:

  • Essential function: Disruption of ubiquinone biosynthesis compromises bacterial energy metabolism.

  • Structural distinctiveness: Bacterial ubiA differs sufficiently from human homologs to allow selective targeting.

  • Antimicrobial resistance context: In H. somni isolates from respiratory diseases, 39.6% showed resistance or intermediate response to one or more antimicrobials , highlighting the need for novel targets.

Drug Discovery Approaches:

  • High-throughput screening:

    • Enzymatic assays adapted to plate formats

    • Cell-based assays measuring bacterial growth inhibition

  • Structure-based design:

    • Homology modeling based on related crystal structures

    • Molecular docking of potential inhibitors

    • Fragment-based screening approaches

  • Known inhibitors of related enzymes:

    • Geranyltransferase inhibitors

    • Other prenyl transferase inhibitors as starting points

How does the genetic background of Histophilus somni influence ubiA expression and function?

The genetic context of ubiA may significantly impact its expression and functionality:

Genetic Analysis Considerations:

  • Regulatory elements: Analysis of upstream regions for promoters and regulatory protein binding sites.

  • Strain variation: Comparison of ubiA sequences across different Histophilus somni isolates may reveal adaptive mutations.

  • Horizontal gene transfer: While not directly mentioned for ubiA, the presence of integrative and conjugative elements (ICEs) has been documented in H. somni , suggesting potential for genetic mobility.

  • Environmental regulation: Expression analysis under different growth conditions (oxygen levels, nutrient availability) to understand context-dependent regulation.

Research Methodology:

  • Comparative genomics across multiple H. somni isolates

  • RNA-Seq analysis under various environmental conditions

  • Promoter fusion studies to identify regulatory mechanisms

  • Assessment of ubiA expression in antimicrobial resistant vs. susceptible strains

What are common challenges in expressing functional recombinant ubiA and how can they be overcome?

Researchers frequently encounter several challenges when working with recombinant ubiA:

Common Expression Challenges and Solutions:

ChallengeManifestationSolution Strategy
Protein toxicityPoor growth after inductionUse tightly regulated expression systems; lower induction temperature
Inclusion body formationInsoluble protein aggregatesCo-express with chaperones; use solubility tags; optimize detergent solubilization
Low yieldMinimal purified proteinScale up culture volume; optimize codon usage; try different fusion tags
Loss of activity during purificationPurified protein lacks enzymatic functionInclude stabilizing agents (glycerol, specific lipids); reduce purification steps
Heterogeneous productMultiple species on SDS-PAGE or SECOptimize buffer conditions; consider limited proteolysis to remove flexible regions

Practical Approach:

  • Begin with small-scale expression trials across multiple conditions

  • Validate protein identity by mass spectrometry

  • Assess membrane integration using fractionation controls

  • Develop activity assays that can be performed in detergent micelles

How can researchers differentiate between specific and non-specific effects in ubiA inhibition studies?

When evaluating potential ubiA inhibitors, distinguishing specific from non-specific effects is critical:

Control Experiments for Inhibition Studies:

  • Counter-screening:

    • Test compounds against unrelated enzymes

    • Assess effects on general bacterial growth

  • Structure-activity relationship (SAR) analysis:

    • Synthesize and test structural analogs

    • Correlate structural features with inhibitory potency

  • Binding confirmation:

    • Thermal shift assays to demonstrate direct binding

    • Isothermal titration calorimetry (ITC) for binding constants

    • Surface plasmon resonance (SPR) for interaction kinetics

  • Resistance generation:

    • Select for resistant mutants and sequence ubiA

    • Introduce identified mutations to confirm their role

  • In silico docking validation:

    • Correlate predicted binding poses with experimental data

    • Molecular dynamics to assess stability of binding interactions

Data Analysis Framework:

  • Establish clear dose-response relationships

  • Calculate and compare IC50 values across multiple assay formats

  • Determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Validate results in whole-cell contexts where possible

What comparative insights can be gained by studying ubiA across different bacterial pathogens?

Comparative analysis of ubiA across bacterial species offers valuable evolutionary and functional insights:

Comparative Research Approaches:

  • Phylogenetic analysis:

    • Construct evolutionary trees based on ubiA sequences

    • Identify conserved vs. variable regions across species

    • Map adaptive mutations to structural models

  • Functional complementation:

    • Express ubiA homologs in E. coli ubiA deletion mutants

    • Quantify restoration of ubiquinone production and growth

    • Identify species-specific functional differences

  • Structural comparison:

    • Generate homology models for different bacterial ubiA proteins

    • Analyze substrate binding pockets and catalytic residues

    • Identify potential species-specific inhibitor binding sites

  • Expression pattern analysis:

    • Compare regulation of ubiA expression across species

    • Identify shared regulatory elements and unique control mechanisms

This comparative approach may reveal why certain species like Histophilus somni display particular patterns of antimicrobial resistance, as observed in the varying resistance rates to different antimicrobials in clinical isolates .

How might advanced structural biology techniques advance our understanding of ubiA function?

Recent advances in structural biology offer new opportunities to understand ubiA at the molecular level:

Cutting-Edge Structural Approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution of membrane proteins without crystallization

    • Visualization of different conformational states

    • Analysis of protein-lipid interactions in native-like environments

  • Solid-state NMR spectroscopy:

    • Structural analysis in lipid environments

    • Dynamic information about catalytic mechanisms

    • Identification of substrate and inhibitor binding sites

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping protein dynamics and conformational changes

    • Identification of allosteric regulation sites

    • Analysis of ligand-induced structural alterations

  • Integrated structural biology approaches:

    • Combining multiple techniques (X-ray crystallography, Cryo-EM, NMR, computational modeling)

    • Building comprehensive models of ubiA function in membrane contexts

    • Understanding how sequence variations impact structure and function

These advanced structural studies could provide crucial insights for rational drug design targeting ubiA and related enzymes in bacterial pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.