Haemophilus somnus, now commonly referred to as Histophilus somni, is a Gram-negative bacterium and opportunistic pathogen associated with multisystemic diseases in bovines . Like other Gram-negative bacteria, H. somnus possesses protein machinery dedicated to the formation of disulfide bonds in periplasmic proteins, which are essential for maintaining proper protein structure and function. The Disulfide bond formation protein B (dsbB) is a key component of this machinery, working in conjunction with other proteins such as DsbA to catalyze disulfide bond formation in bacterial periplasmic spaces.
The recombinant form of Haemophilus somnus Disulfide bond formation protein B (dsbB) refers to the protein that has been produced using genetic engineering techniques, typically in expression systems such as Escherichia coli. This approach allows researchers to obtain purified protein for structural and functional studies, as well as for potential applications in biotechnology and pharmaceutical development. The recombinant protein typically includes a tag (such as a histidine tag) to facilitate purification and may be expressed as the full-length protein or specific domains depending on the research requirements.
Recombinant H. somnus dsbB protein is part of the broader family of DsbB proteins found across various bacterial species, all of which play crucial roles in the oxidative protein folding pathway. This pathway is essential for bacterial survival and virulence, making DsbB proteins potential targets for antimicrobial development. The availability of recombinant versions of these proteins has significantly advanced our understanding of their structure-function relationships and mechanisms of action.
The Disulfide bond formation protein B (dsbB) from Haemophilus somnus functions as an integral component of the bacterial disulfide bond formation pathway. In this pathway, DsbB serves as an enzyme that oxidizes the periplasmic protein DsbA, which in turn transfers disulfide bonds to substrate proteins in the periplasm . This oxidation-reduction cascade is crucial for the proper folding and stability of many secreted and membrane-associated bacterial proteins.
The mechanism of action of DsbB involves a sophisticated electron transfer process. DsbB acts as a redox potential transducer across the cytoplasmic membrane, transferring electrons from DsbA to electron acceptors in the respiratory chain, such as ubiquinone or menaquinone . This connection to the respiratory chain enables the continuous regeneration of oxidized DsbA, which is necessary for ongoing disulfide bond formation in newly synthesized periplasmic proteins.
The catalytic activity of DsbB relies on the redox-active cysteine residues located in its periplasmic loops. These cysteines undergo alternating oxidation and reduction as part of the electron transfer process. The first periplasmic domain typically contains a Cys-X-Y-Cys configuration that is characteristic of active sites in proteins involved in disulfide bond formation, including DsbA and protein disulfide isomerase . This conserved motif plays a critical role in the protein's ability to catalyze disulfide exchange reactions.
When DsbB interacts with reduced DsbA, it catalyzes the oxidation of DsbA's active site cysteines, forming a transient mixed disulfide complex between the two proteins. Subsequently, this disulfide is transferred to DsbA, while DsbB's cysteines are re-oxidized through electron transfer to quinones in the membrane. Kinetic studies of DsbB proteins have shown that the rate of the initial interaction with DsbA is highly dependent on DsbA concentration, with a rate constant of approximately 5 × 10^5 M^-1 s^-1 . This efficient catalysis ensures rapid recycling of DsbA, maintaining the cell's capacity for disulfide bond formation.
The functional importance of DsbB is underscored by its conservation across many bacterial species and its essential role in virulence and survival. By facilitating proper protein folding, DsbB contributes to the structural integrity of numerous bacterial proteins involved in pathogenesis, making it a potential target for antimicrobial development.
Recombinant Haemophilus somnus Disulfide bond formation protein B has several important applications in scientific research and biotechnological development. As a key component of bacterial disulfide bond formation, this protein serves as a valuable tool for studying oxidative protein folding mechanisms and their role in bacterial physiology. Research applications range from fundamental biochemical studies to the development of novel antimicrobial strategies targeting bacterial virulence.
Structural biology has benefited significantly from the availability of recombinant DsbB proteins, enabling researchers to determine three-dimensional structures and elucidate the molecular basis of disulfide bond formation. These structural insights contribute to our understanding of membrane protein function and the mechanisms of electron transfer across biological membranes. X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy of recombinant DsbB proteins have revealed critical details about their active sites and interaction surfaces.
In enzymatic studies, recombinant H. somnus dsbB serves as a model for investigating the kinetics and thermodynamics of disulfide bond formation. Researchers have utilized stopped-flow methods and spectroscopic techniques to study the reaction intermediates and catalytic efficiency of DsbB proteins. For instance, studies on E. coli DsbB have shown that upon mixing oxidized DsbB and reduced DsbA, there is a rapid increase in absorbance at 510 nm, followed by slower decay phases, indicating a complex reaction mechanism . Similar approaches can be applied to H. somnus dsbB to reveal species-specific catalytic properties.
The disulfide bond formation pathway represents a potential target for antimicrobial development, as it is essential for the proper folding of many virulence factors in pathogenic bacteria. Recombinant H. somnus dsbB can be used in high-throughput screening assays to identify compounds that inhibit its activity, potentially leading to new antibiotic candidates. Such inhibitors could disrupt bacterial protein folding and compromise pathogen virulence without directly killing bacteria, potentially reducing the selective pressure for resistance development.
Additionally, recombinant DsbB proteins have potential applications in biotechnology for the production of correctly folded disulfide-containing proteins in bacterial expression systems. By enhancing the cell's capacity for disulfide bond formation, these proteins could improve the yield and quality of recombinant protein products, particularly those requiring disulfide bonds for proper folding and function.
Disulfide bond formation protein B is conserved across many bacterial species, with variations in sequence and specific properties while maintaining its core functional role in disulfide bond formation. A comparative analysis of H. somnus dsbB with homologs from other bacterial species reveals both conservation of critical features and species-specific adaptations that may reflect different physiological requirements or environmental niches.
When comparing the amino acid sequences of H. somnus dsbB with its counterpart in Haemophilus influenzae, significant similarities are evident, reflecting their evolutionary relationship. The H. influenzae DsbB protein consists of 177 amino acids and contains the sequence: MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGTI ALLQPRVFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN . Both proteins share conserved cysteine residues and similar hydrophobic profiles consistent with their membrane-spanning nature.
The E. coli DsbB protein, which has been extensively studied, provides a well-characterized reference point for understanding DsbB function across species. E. coli DsbB spans the membrane four times with both the N- and C-termini located in the cytoplasm, and its periplasmic domains contain two pairs of essential cysteines . Similar topological arrangements are predicted for H. somnus dsbB, suggesting a conserved structural framework for function.
Despite these similarities, species-specific differences in DsbB proteins may reflect adaptations to different cellular environments or functional requirements. These variations could include differences in quinone specificity (ubiquinone versus menaquinone), kinetic parameters, or interactions with partner proteins. Such differences might be particularly relevant when considering DsbB as a target for species-specific antimicrobial development.
The table below compares key features of DsbB proteins from Haemophilus somnus, Haemophilus influenzae, and Escherichia coli:
| Feature | H. somnus DsbB | H. influenzae DsbB | E. coli DsbB |
|---|---|---|---|
| Length | 177 amino acids | 177 amino acids | 176 amino acids |
| Transmembrane domains | Predicted 4 | Predicted 4 | 4 confirmed |
| Active site cysteines | Present in periplasmic loops | Present in periplasmic loops | Cys41-Cys44 and Cys104-Cys130 |
| Quinone interaction | Predicted | Predicted | Confirmed with ubiquinone/menaquinone |
| Role in virulence | Associated with pathogenesis | Associated with pathogenesis | Well-established |
Understanding these cross-species similarities and differences provides valuable insights into the evolution of disulfide bond formation mechanisms and may guide strategies for developing targeted interventions against specific bacterial pathogens. The conservation of DsbB across bacterial species underscores its fundamental importance in bacterial physiology and protein homeostasis.
KEGG: hso:HS_0624
STRING: 205914.HS_0624
H. somnus DsbB is an inner membrane protein that plays a critical role in the oxidative pathway of disulfide bond formation. Similar to the well-characterized E. coli DsbB, this protein likely functions by re-oxidizing DsbA after it has transferred its disulfide bond to substrate proteins. This creates a catalytic cycle where DsbB maintains DsbA in its active, oxidized state, allowing for continuous disulfide bond formation in bacterial proteins .
In H. somnus, a pathogen associated with bovine respiratory disease, DsbB would be particularly important for the proper folding of virulence factors. The disulfide bond formation system is essential for bacterial pathogenicity as many secreted and membrane proteins require disulfide bonds for structural stability and function .
DsbB contains four transmembrane segments and two periplasmic loops, each containing one pair of conserved, essential catalytic cysteine residues. This architecture positions the cysteine pairs optimally for sequential electron transfer. The protein converts the reduced form of DsbA back to its oxidized state through a thiol-disulfide exchange reaction .
The specificity of DsbB is remarkable - under physiological conditions, it primarily oxidizes DsbA through rapid disulfide exchange. This specificity ensures the directional flow of electrons from substrate proteins through DsbA to DsbB, and finally to the respiratory chain via quinones (ubiquinone during aerobic growth or menaquinone during anaerobic growth) .
To effectively study H. somnus DsbB in vitro, researchers should consider:
Protein expression systems: Membrane proteins like DsbB present specific challenges, often requiring specialized E. coli strains such as C41/C43(DE3) that are optimized for membrane protein expression.
Detergent selection: Careful screening of detergents for extraction and purification is critical to maintain the native structure and function of DsbB.
Activity assays: In vitro assays can be established by monitoring:
DsbA oxidation using purified components
Quinone reduction spectrophotometrically
Thiol-disulfide exchange using fluorescent probes
Reconstitution systems: Proteoliposomes or nanodiscs can provide a more native-like membrane environment for functional studies .
While specific information about H. somnus dsbB gene organization is limited, inferences can be drawn from other bacterial systems. In E. coli, dsbB is expressed as a monocistronic unit located at a different chromosomal locus than dsbA . The genomic context of the dsbB gene in H. somnus would provide insights into its regulation and potential functional relationships.
Of particular interest would be the relationship between dsbB and virulence-associated genes in H. somnus, such as the immunoglobulin binding protein genes (ibpA and ibpB). In H. somnus, the ibpA gene encodes both high-molecular-weight (HMW) immunoglobulin binding proteins and the p76 surface protein within a single 12,285 base pair open reading frame . Understanding whether dsbB expression is coordinated with these virulence factors would illuminate pathogenicity mechanisms.
Creating and validating H. somnus dsbB mutants requires specialized approaches:
Mutagenesis strategies:
Site-directed mutagenesis for targeted cysteine modifications
Genetic knockout approaches to assess essentiality
Complementation studies to confirm phenotypes
Validation methods:
Western blotting to verify protein expression
Membrane fractionation to confirm proper localization
Functional assays to assess disulfide bond formation capacity
Phenotypic analysis:
Assessment of virulence factor production and function
Evaluation of resistance to oxidative stress
Testing survival under various environmental conditions
Since DsbB is likely essential for proper virulence factor folding, mutants may display reduced pathogenicity in infection models .
Sequence analysis of DsbB proteins across bacterial species reveals:
Highly conserved catalytic cysteine residues that are essential for function
Conserved transmembrane topology that positions functional domains
Species-specific variations that may reflect adaptation to different ecological niches
This conservation analysis guides experimental design by highlighting:
Critical residues for site-directed mutagenesis
Regions likely involved in specific interactions with DsbA or quinones
Potential species-specific functional adaptations
Comparative studies between H. somnus DsbB and well-characterized homologs like E. coli DsbB can provide insights into both conserved mechanisms and pathogen-specific adaptations .
The optimal expression of recombinant H. somnus DsbB presents significant challenges due to its membrane-embedded nature. Based on experiences with similar proteins, these strategies may be effective:
E. coli expression systems:
C41/C43(DE3) strains specifically engineered for membrane protein expression
Tightly controlled induction using systems like the arabinose-inducible promoter
Lower temperature expression (16-20°C) to slow folding and membrane insertion
Affinity tags considerations:
N-terminal or C-terminal His6 tags for purification
Fusion partners like MBP that can enhance solubility
Inclusion of protease cleavage sites for tag removal
Expression monitoring:
Western blot analysis to confirm expression
Fluorescent fusion constructs to track membrane localization
Small-scale optimization before scaling up
The goal is to obtain correctly folded, functional protein integrated into the membrane .
Purifying membrane proteins like DsbB requires specialized techniques:
| Purification Step | Methodology | Critical Considerations |
|---|---|---|
| Membrane isolation | Differential centrifugation | Buffer composition, protease inhibitors |
| Detergent extraction | Screening detergents (DDM, LMNG, etc.) | Detergent concentration, solubilization time |
| Affinity chromatography | IMAC (Ni-NTA) for His-tagged protein | Imidazole concentration, flow rate |
| Size exclusion | Superdex 200 or similar | Buffer compatibility, protein concentration |
| Quality assessment | SEC-MALS, thermal shift assays | Monodispersity, stability |
Membrane extraction studies for H. somnus proteins have shown that integral outer membrane proteins are Sarkosyl insoluble, while peripheral membrane proteins like p76 are found in the Sarkosyl-soluble fraction . This information may guide fractionation approaches for DsbB purification.
Verifying proper folding and activity of recombinant DsbB requires multiple complementary approaches:
Structural assessment:
Circular dichroism (CD) spectroscopy to confirm secondary structure content
Size exclusion chromatography to evaluate oligomeric state
Limited proteolysis to probe for proper folding
Functional validation:
DsbA oxidation assays measuring the ability to convert reduced DsbA to its oxidized form
Quinone reduction assays monitoring electron transfer to respiratory chain components
Complementation of E. coli dsbB mutants to demonstrate functional activity
Binding studies:
Interaction with DsbA using techniques like isothermal titration calorimetry
Quinone binding studies using fluorescence quenching or other spectroscopic methods
These multiple lines of evidence collectively verify that the recombinant protein maintains native-like properties .
DsbB has the unique ability to generate disulfide bonds through quinone reduction, a process that involves several coordinated steps:
Initial state: DsbB contains two pairs of cysteines (in E. coli, Cys41/Cys44 and Cys104/Cys130) that participate in the reaction.
Electron flow pathway:
Reduced DsbA transfers electrons to the Cys104/Cys130 pair of DsbB
Electrons move internally from Cys104/Cys130 to Cys41/Cys44
The Cys41/Cys44 pair transfers electrons to bound quinone
Reduced quinone enters the respiratory chain
Energetics: This process is thermodynamically favorable due to the sequential arrangement of redox potentials, allowing electron flow from reduced proteins ultimately to the respiratory chain .
The ability to generate disulfide bonds de novo distinguishes DsbB from other disulfide isomerases that merely rearrange existing disulfide bonds and represents a critical mechanism for introducing these bonds into newly synthesized proteins .
The relationship between DsbB and virulence in H. somnus likely involves several mechanisms:
Disulfide-dependent virulence factors: Many bacterial virulence factors require disulfide bonds for structural stability and function. DsbB, through its role in maintaining DsbA in an oxidized state, would be essential for the proper folding of these factors.
Specific H. somnus virulence proteins: H. somnus produces immunoglobulin binding proteins (IgBPs), including high-molecular-weight (HMW) IgBPs and the 76-kDa surface protein (p76), which are associated with serum resistance and virulence . These proteins may require disulfide bonds for proper folding and function.
Surface structure formation: Virulent H. somnus strains possess a surface fibrillar network with IgG2 binding activity . The formation and stability of this network might depend on proper disulfide bond formation catalyzed by the DsbA/DsbB system.
In experimental bovine respiratory tract disease models, H. somnus causes necrotizing, suppurative lobular bronchopneumonia and pleuritis , potentially through virulence factors that depend on proper disulfide bond formation.
Environmental conditions significantly impact DsbB function through several mechanisms:
Oxygen availability:
Redox environment:
Exposure to reducing agents can impair DsbB function
Oxidative stress may enhance activity but potentially cause non-specific disulfide formation
pH and ionic conditions:
These factors affect the redox potential of the catalytic cysteines
Optimal function likely occurs at physiological pH (6-7) found in the host environment
These environmental adaptations are particularly relevant for pathogens like H. somnus that must function in diverse host microenvironments during infection .
Structural studies of H. somnus DsbB could reveal several potential targets for antimicrobial development:
Quinone binding site: This site is essential for DsbB function and differs from human proteins, making it an attractive target for selective inhibition. Small molecules that compete with quinone binding could block electron transfer and disrupt disulfide bond formation.
DsbA-DsbB interaction interface: Compounds that disrupt this critical protein-protein interaction could effectively block the entire oxidative folding pathway.
Transmembrane region: Molecules that destabilize membrane insertion or disrupt conformational changes could inhibit function.
Since many virulence factors in H. somnus depend on proper disulfide bond formation, inhibitors of DsbB could potentially attenuate virulence without directly killing bacteria, potentially reducing selection pressure for resistance development .
Developing robust in vitro assays for H. somnus DsbB activity presents several technical challenges:
Membrane protein stability:
Maintaining native conformation outside the membrane environment
Finding suitable detergents or membrane mimetics
Preventing aggregation during storage and assays
Coupled enzyme systems:
Reconstituting the DsbA-DsbB electron transfer pathway
Selecting appropriate electron acceptors (quinones)
Developing sensitive detection methods for disulfide formation
Physiological relevance:
Ensuring in vitro conditions reflect the in vivo environment
Correlating biochemical activity with biological function
Accounting for potential regulatory factors present in vivo
Despite these challenges, recent advances in membrane protein biochemistry provide promising approaches, including nanodiscs, amphipols, and fluorescence-based redox sensors that can facilitate these studies .
H. somnus DsbB could inform vaccine development through several strategies:
Direct targeting:
Though DsbB itself is not an ideal vaccine antigen due to limited surface exposure, understanding its role in virulence factor maturation is valuable
Identifying DsbB-dependent surface antigens for vaccine development
Attenuated vaccine strains:
Modified DsbB function could create attenuated strains with reduced virulence but retained immunogenicity
Temperature-sensitive DsbB mutants could provide self-limiting vaccine candidates
Subunit vaccine components:
Studies have demonstrated that vaccination with immunoglobulin binding proteins of H. somnus can provide protection against intrabronchial challenge. Specifically, calves immunized with the GST-IbpA3 peptide fragment (amino acids 972-1515) showed protection in preliminary studies .
While specific structural data for H. somnus DsbB is limited, comparative analysis with the well-characterized E. coli DsbB provides valuable insights:
| Feature | E. coli DsbB | Predicted H. somnus DsbB | Functional Significance |
|---|---|---|---|
| Transmembrane domains | 4 | Likely 4 | Essential for membrane anchoring and quinone interaction |
| Periplasmic loops | 2 with catalytic cysteines | Likely conserved | Critical for DsbA interaction and electron transfer |
| Cysteine pairs | Cys41/44 and Cys104/130 | Likely conserved positions | Essential for catalytic activity |
| Quinone interaction | Q loop between TM1-TM2 | Likely conserved | Electron transfer to respiratory chain |
| DsbA specificity | High specificity | May have species-specific adaptations | Determines efficiency of the oxidative pathway |
These structural similarities would suggest a conserved catalytic mechanism, though species-specific variations might reflect adaptation to different ecological niches or host environments .
Comparative genomic studies of DsbB across bacterial species reveal several important insights:
Conservation patterns:
Core catalytic elements (cysteine pairs) are highly conserved
Transmembrane topology is preserved across diverse species
Species-specific variations occur primarily in non-catalytic regions
Genomic context:
Variable organization of dsb genes across bacterial phyla
Co-evolution with specific DsbA variants
Association with particular sets of virulence genes in pathogens
Adaptive significance:
Environmental niche-specific adaptations
Host-specific variations in pathogens
Correlation with bacterial lifestyle (pathogenic vs. commensal)
These evolutionary insights help identify conserved functional elements that are essential for activity versus adaptable regions that may confer species-specific properties .
The H. somnus Dsb system likely integrates with other bacterial redox systems through several mechanisms:
Respiratory chain connection:
DsbB transfers electrons to quinones that feed into the respiratory chain
This creates a link between protein folding and energy generation
Environmental conditions affecting respiration would influence disulfide bond formation
Interaction with isomerization pathway:
Stress response integration:
Redox stress response systems may modulate Dsb activity
Changes in periplasmic redox conditions during infection could affect pathway balance
Adaptation to host defense mechanisms like oxidative burst
This integration ensures that disulfide bond formation responds appropriately to changing environmental conditions during host colonization and infection .
H. somnus DsbB could contribute to vaccine development strategies for bovine respiratory disease through several approaches:
Attenuated strain development:
Controlled modification of DsbB function could create strains with reduced virulence
Such strains would potentially retain immunogenicity while limiting pathogenic potential
Temperature-sensitive mutants could provide self-limiting vaccine candidates
Identification of vaccine antigens:
Understanding which virulence factors depend on DsbB for proper folding helps identify potential protective antigens
Focus on surface-exposed, DsbB-dependent proteins that elicit strong immune responses
Combination vaccines:
Integration with other approaches targeting H. somnus virulence
Potential synergy with vaccines against other bovine respiratory pathogens
Research has demonstrated that calves vaccinated against H. somnus show reduced risk of undifferentiated bovine respiratory disease, suggesting the feasibility of effective vaccine development . The immunoglobulin binding proteins of H. somnus, which may depend on proper disulfide bond formation, have shown promise as vaccine candidates in preliminary studies .
Advanced structural biology techniques can significantly enhance our understanding of H. somnus DsbB:
Cryo-electron microscopy (cryo-EM):
Allows visualization of membrane proteins without crystallization
Can capture different conformational states during the catalytic cycle
Provides insights into membrane embedding and protein-protein interactions
X-ray crystallography:
High-resolution structural details of binding sites and catalytic centers
Comparison with known DsbB structures from other bacteria
Co-crystallization with interaction partners or inhibitors
Hydrogen-deuterium exchange mass spectrometry (HDX-MS):
Maps dynamics and conformational changes during catalysis
Identifies regions involved in protein-protein interactions
Provides information about solvent accessibility and structural flexibility
These structural insights would facilitate rational drug design targeting DsbB and advance our understanding of the molecular mechanisms of disulfide bond formation .
Several innovative approaches could address current limitations in studying H. somnus DsbB:
Membrane mimetic systems:
Nanodiscs provide a defined lipid environment with improved stability
Styrene-maleic acid copolymer lipid particles (SMALPs) allow extraction without detergents
Microfluidic platforms for high-throughput screening of conditions
Advanced genetic tools:
CRISPR-Cas9 for precise genomic editing in H. somnus
Conditional expression systems for essential genes
Fluorescent reporters for real-time monitoring of disulfide bond formation
Single-molecule techniques:
Fluorescence resonance energy transfer (FRET) to monitor conformational changes
Optical tweezers to study protein-protein interactions
Super-resolution microscopy to visualize DsbB localization in bacterial cells
These approaches would overcome limitations of traditional biochemical methods and provide new insights into the dynamics and regulation of DsbB function in its native context .