Recombinant Haemophilus somnus Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Haemophilus somnus Disulfide Bond Formation Protein B

Haemophilus somnus, now commonly referred to as Histophilus somni, is a Gram-negative bacterium and opportunistic pathogen associated with multisystemic diseases in bovines . Like other Gram-negative bacteria, H. somnus possesses protein machinery dedicated to the formation of disulfide bonds in periplasmic proteins, which are essential for maintaining proper protein structure and function. The Disulfide bond formation protein B (dsbB) is a key component of this machinery, working in conjunction with other proteins such as DsbA to catalyze disulfide bond formation in bacterial periplasmic spaces.

The recombinant form of Haemophilus somnus Disulfide bond formation protein B (dsbB) refers to the protein that has been produced using genetic engineering techniques, typically in expression systems such as Escherichia coli. This approach allows researchers to obtain purified protein for structural and functional studies, as well as for potential applications in biotechnology and pharmaceutical development. The recombinant protein typically includes a tag (such as a histidine tag) to facilitate purification and may be expressed as the full-length protein or specific domains depending on the research requirements.

Recombinant H. somnus dsbB protein is part of the broader family of DsbB proteins found across various bacterial species, all of which play crucial roles in the oxidative protein folding pathway. This pathway is essential for bacterial survival and virulence, making DsbB proteins potential targets for antimicrobial development. The availability of recombinant versions of these proteins has significantly advanced our understanding of their structure-function relationships and mechanisms of action.

Function and Mechanism of H. somnus DsbB

The Disulfide bond formation protein B (dsbB) from Haemophilus somnus functions as an integral component of the bacterial disulfide bond formation pathway. In this pathway, DsbB serves as an enzyme that oxidizes the periplasmic protein DsbA, which in turn transfers disulfide bonds to substrate proteins in the periplasm . This oxidation-reduction cascade is crucial for the proper folding and stability of many secreted and membrane-associated bacterial proteins.

The mechanism of action of DsbB involves a sophisticated electron transfer process. DsbB acts as a redox potential transducer across the cytoplasmic membrane, transferring electrons from DsbA to electron acceptors in the respiratory chain, such as ubiquinone or menaquinone . This connection to the respiratory chain enables the continuous regeneration of oxidized DsbA, which is necessary for ongoing disulfide bond formation in newly synthesized periplasmic proteins.

The catalytic activity of DsbB relies on the redox-active cysteine residues located in its periplasmic loops. These cysteines undergo alternating oxidation and reduction as part of the electron transfer process. The first periplasmic domain typically contains a Cys-X-Y-Cys configuration that is characteristic of active sites in proteins involved in disulfide bond formation, including DsbA and protein disulfide isomerase . This conserved motif plays a critical role in the protein's ability to catalyze disulfide exchange reactions.

When DsbB interacts with reduced DsbA, it catalyzes the oxidation of DsbA's active site cysteines, forming a transient mixed disulfide complex between the two proteins. Subsequently, this disulfide is transferred to DsbA, while DsbB's cysteines are re-oxidized through electron transfer to quinones in the membrane. Kinetic studies of DsbB proteins have shown that the rate of the initial interaction with DsbA is highly dependent on DsbA concentration, with a rate constant of approximately 5 × 10^5 M^-1 s^-1 . This efficient catalysis ensures rapid recycling of DsbA, maintaining the cell's capacity for disulfide bond formation.

The functional importance of DsbB is underscored by its conservation across many bacterial species and its essential role in virulence and survival. By facilitating proper protein folding, DsbB contributes to the structural integrity of numerous bacterial proteins involved in pathogenesis, making it a potential target for antimicrobial development.

Applications in Research and Biotechnology

Recombinant Haemophilus somnus Disulfide bond formation protein B has several important applications in scientific research and biotechnological development. As a key component of bacterial disulfide bond formation, this protein serves as a valuable tool for studying oxidative protein folding mechanisms and their role in bacterial physiology. Research applications range from fundamental biochemical studies to the development of novel antimicrobial strategies targeting bacterial virulence.

Structural biology has benefited significantly from the availability of recombinant DsbB proteins, enabling researchers to determine three-dimensional structures and elucidate the molecular basis of disulfide bond formation. These structural insights contribute to our understanding of membrane protein function and the mechanisms of electron transfer across biological membranes. X-ray crystallography and nuclear magnetic resonance (NMR) spectroscopy of recombinant DsbB proteins have revealed critical details about their active sites and interaction surfaces.

In enzymatic studies, recombinant H. somnus dsbB serves as a model for investigating the kinetics and thermodynamics of disulfide bond formation. Researchers have utilized stopped-flow methods and spectroscopic techniques to study the reaction intermediates and catalytic efficiency of DsbB proteins. For instance, studies on E. coli DsbB have shown that upon mixing oxidized DsbB and reduced DsbA, there is a rapid increase in absorbance at 510 nm, followed by slower decay phases, indicating a complex reaction mechanism . Similar approaches can be applied to H. somnus dsbB to reveal species-specific catalytic properties.

The disulfide bond formation pathway represents a potential target for antimicrobial development, as it is essential for the proper folding of many virulence factors in pathogenic bacteria. Recombinant H. somnus dsbB can be used in high-throughput screening assays to identify compounds that inhibit its activity, potentially leading to new antibiotic candidates. Such inhibitors could disrupt bacterial protein folding and compromise pathogen virulence without directly killing bacteria, potentially reducing the selective pressure for resistance development.

Additionally, recombinant DsbB proteins have potential applications in biotechnology for the production of correctly folded disulfide-containing proteins in bacterial expression systems. By enhancing the cell's capacity for disulfide bond formation, these proteins could improve the yield and quality of recombinant protein products, particularly those requiring disulfide bonds for proper folding and function.

Comparison with DsbB Proteins from Other Species

Disulfide bond formation protein B is conserved across many bacterial species, with variations in sequence and specific properties while maintaining its core functional role in disulfide bond formation. A comparative analysis of H. somnus dsbB with homologs from other bacterial species reveals both conservation of critical features and species-specific adaptations that may reflect different physiological requirements or environmental niches.

When comparing the amino acid sequences of H. somnus dsbB with its counterpart in Haemophilus influenzae, significant similarities are evident, reflecting their evolutionary relationship. The H. influenzae DsbB protein consists of 177 amino acids and contains the sequence: MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGTI ALLQPRVFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN . Both proteins share conserved cysteine residues and similar hydrophobic profiles consistent with their membrane-spanning nature.

The E. coli DsbB protein, which has been extensively studied, provides a well-characterized reference point for understanding DsbB function across species. E. coli DsbB spans the membrane four times with both the N- and C-termini located in the cytoplasm, and its periplasmic domains contain two pairs of essential cysteines . Similar topological arrangements are predicted for H. somnus dsbB, suggesting a conserved structural framework for function.

Despite these similarities, species-specific differences in DsbB proteins may reflect adaptations to different cellular environments or functional requirements. These variations could include differences in quinone specificity (ubiquinone versus menaquinone), kinetic parameters, or interactions with partner proteins. Such differences might be particularly relevant when considering DsbB as a target for species-specific antimicrobial development.

The table below compares key features of DsbB proteins from Haemophilus somnus, Haemophilus influenzae, and Escherichia coli:

FeatureH. somnus DsbBH. influenzae DsbBE. coli DsbB
Length177 amino acids177 amino acids176 amino acids
Transmembrane domainsPredicted 4Predicted 44 confirmed
Active site cysteinesPresent in periplasmic loopsPresent in periplasmic loopsCys41-Cys44 and Cys104-Cys130
Quinone interactionPredictedPredictedConfirmed with ubiquinone/menaquinone
Role in virulenceAssociated with pathogenesisAssociated with pathogenesisWell-established

Understanding these cross-species similarities and differences provides valuable insights into the evolution of disulfide bond formation mechanisms and may guide strategies for developing targeted interventions against specific bacterial pathogens. The conservation of DsbB across bacterial species underscores its fundamental importance in bacterial physiology and protein homeostasis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requests in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: Our proteins are shipped standard with normal blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
dsbB; HS_0624; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Haemophilus somnus (strain 129Pt) (Histophilus somni)
Target Names
dsbB
Target Protein Sequence
MLIFFKNLSMKRSTWILLFISALVLESTALYFQHGMGLNPCVMCIYERVAILGILFSGLI GCIAPKWLVLRILALLIGLGSAVKGLLLAIKHLDYQINVYPWNQCAMVPDFPQTLPLDKW FPNIFMPSGSCSDITWSFLGFSMVQWIIVIFACYFLFFIILSISQFKKVRKNRMLFR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Functions by oxidizing the DsbA protein.
Database Links

KEGG: hso:HS_0624

STRING: 205914.HS_0624

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus DsbB and what is its role in bacterial physiology?

H. somnus DsbB is an inner membrane protein that plays a critical role in the oxidative pathway of disulfide bond formation. Similar to the well-characterized E. coli DsbB, this protein likely functions by re-oxidizing DsbA after it has transferred its disulfide bond to substrate proteins. This creates a catalytic cycle where DsbB maintains DsbA in its active, oxidized state, allowing for continuous disulfide bond formation in bacterial proteins .

In H. somnus, a pathogen associated with bovine respiratory disease, DsbB would be particularly important for the proper folding of virulence factors. The disulfide bond formation system is essential for bacterial pathogenicity as many secreted and membrane proteins require disulfide bonds for structural stability and function .

How does the structure of DsbB enable its function in disulfide bond formation?

DsbB contains four transmembrane segments and two periplasmic loops, each containing one pair of conserved, essential catalytic cysteine residues. This architecture positions the cysteine pairs optimally for sequential electron transfer. The protein converts the reduced form of DsbA back to its oxidized state through a thiol-disulfide exchange reaction .

The specificity of DsbB is remarkable - under physiological conditions, it primarily oxidizes DsbA through rapid disulfide exchange. This specificity ensures the directional flow of electrons from substrate proteins through DsbA to DsbB, and finally to the respiratory chain via quinones (ubiquinone during aerobic growth or menaquinone during anaerobic growth) .

What methodologies are most effective for studying H. somnus DsbB in vitro?

To effectively study H. somnus DsbB in vitro, researchers should consider:

  • Protein expression systems: Membrane proteins like DsbB present specific challenges, often requiring specialized E. coli strains such as C41/C43(DE3) that are optimized for membrane protein expression.

  • Detergent selection: Careful screening of detergents for extraction and purification is critical to maintain the native structure and function of DsbB.

  • Activity assays: In vitro assays can be established by monitoring:

    • DsbA oxidation using purified components

    • Quinone reduction spectrophotometrically

    • Thiol-disulfide exchange using fluorescent probes

  • Reconstitution systems: Proteoliposomes or nanodiscs can provide a more native-like membrane environment for functional studies .

How is the dsbB gene organized in H. somnus compared to other bacteria?

While specific information about H. somnus dsbB gene organization is limited, inferences can be drawn from other bacterial systems. In E. coli, dsbB is expressed as a monocistronic unit located at a different chromosomal locus than dsbA . The genomic context of the dsbB gene in H. somnus would provide insights into its regulation and potential functional relationships.

Of particular interest would be the relationship between dsbB and virulence-associated genes in H. somnus, such as the immunoglobulin binding protein genes (ibpA and ibpB). In H. somnus, the ibpA gene encodes both high-molecular-weight (HMW) immunoglobulin binding proteins and the p76 surface protein within a single 12,285 base pair open reading frame . Understanding whether dsbB expression is coordinated with these virulence factors would illuminate pathogenicity mechanisms.

What approaches can be used to generate and validate H. somnus dsbB mutants?

Creating and validating H. somnus dsbB mutants requires specialized approaches:

  • Mutagenesis strategies:

    • Site-directed mutagenesis for targeted cysteine modifications

    • Genetic knockout approaches to assess essentiality

    • Complementation studies to confirm phenotypes

  • Validation methods:

    • Western blotting to verify protein expression

    • Membrane fractionation to confirm proper localization

    • Functional assays to assess disulfide bond formation capacity

  • Phenotypic analysis:

    • Assessment of virulence factor production and function

    • Evaluation of resistance to oxidative stress

    • Testing survival under various environmental conditions

Since DsbB is likely essential for proper virulence factor folding, mutants may display reduced pathogenicity in infection models .

How does sequence conservation of DsbB across bacterial species inform functional studies?

Sequence analysis of DsbB proteins across bacterial species reveals:

  • Highly conserved catalytic cysteine residues that are essential for function

  • Conserved transmembrane topology that positions functional domains

  • Species-specific variations that may reflect adaptation to different ecological niches

This conservation analysis guides experimental design by highlighting:

  • Critical residues for site-directed mutagenesis

  • Regions likely involved in specific interactions with DsbA or quinones

  • Potential species-specific functional adaptations

Comparative studies between H. somnus DsbB and well-characterized homologs like E. coli DsbB can provide insights into both conserved mechanisms and pathogen-specific adaptations .

What expression systems are optimal for producing recombinant H. somnus DsbB?

The optimal expression of recombinant H. somnus DsbB presents significant challenges due to its membrane-embedded nature. Based on experiences with similar proteins, these strategies may be effective:

  • E. coli expression systems:

    • C41/C43(DE3) strains specifically engineered for membrane protein expression

    • Tightly controlled induction using systems like the arabinose-inducible promoter

    • Lower temperature expression (16-20°C) to slow folding and membrane insertion

  • Affinity tags considerations:

    • N-terminal or C-terminal His6 tags for purification

    • Fusion partners like MBP that can enhance solubility

    • Inclusion of protease cleavage sites for tag removal

  • Expression monitoring:

    • Western blot analysis to confirm expression

    • Fluorescent fusion constructs to track membrane localization

    • Small-scale optimization before scaling up

The goal is to obtain correctly folded, functional protein integrated into the membrane .

What purification approaches effectively isolate active H. somnus DsbB?

Purifying membrane proteins like DsbB requires specialized techniques:

Purification StepMethodologyCritical Considerations
Membrane isolationDifferential centrifugationBuffer composition, protease inhibitors
Detergent extractionScreening detergents (DDM, LMNG, etc.)Detergent concentration, solubilization time
Affinity chromatographyIMAC (Ni-NTA) for His-tagged proteinImidazole concentration, flow rate
Size exclusionSuperdex 200 or similarBuffer compatibility, protein concentration
Quality assessmentSEC-MALS, thermal shift assaysMonodispersity, stability

Membrane extraction studies for H. somnus proteins have shown that integral outer membrane proteins are Sarkosyl insoluble, while peripheral membrane proteins like p76 are found in the Sarkosyl-soluble fraction . This information may guide fractionation approaches for DsbB purification.

How can researchers verify the structural integrity and activity of purified recombinant H. somnus DsbB?

Verifying proper folding and activity of recombinant DsbB requires multiple complementary approaches:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Size exclusion chromatography to evaluate oligomeric state

    • Limited proteolysis to probe for proper folding

  • Functional validation:

    • DsbA oxidation assays measuring the ability to convert reduced DsbA to its oxidized form

    • Quinone reduction assays monitoring electron transfer to respiratory chain components

    • Complementation of E. coli dsbB mutants to demonstrate functional activity

  • Binding studies:

    • Interaction with DsbA using techniques like isothermal titration calorimetry

    • Quinone binding studies using fluorescence quenching or other spectroscopic methods

These multiple lines of evidence collectively verify that the recombinant protein maintains native-like properties .

How does DsbB generate disulfide bonds de novo through quinone reduction?

DsbB has the unique ability to generate disulfide bonds through quinone reduction, a process that involves several coordinated steps:

  • Initial state: DsbB contains two pairs of cysteines (in E. coli, Cys41/Cys44 and Cys104/Cys130) that participate in the reaction.

  • Electron flow pathway:

    • Reduced DsbA transfers electrons to the Cys104/Cys130 pair of DsbB

    • Electrons move internally from Cys104/Cys130 to Cys41/Cys44

    • The Cys41/Cys44 pair transfers electrons to bound quinone

    • Reduced quinone enters the respiratory chain

  • Energetics: This process is thermodynamically favorable due to the sequential arrangement of redox potentials, allowing electron flow from reduced proteins ultimately to the respiratory chain .

The ability to generate disulfide bonds de novo distinguishes DsbB from other disulfide isomerases that merely rearrange existing disulfide bonds and represents a critical mechanism for introducing these bonds into newly synthesized proteins .

What is the relationship between H. somnus DsbB and virulence factor maturation?

The relationship between DsbB and virulence in H. somnus likely involves several mechanisms:

  • Disulfide-dependent virulence factors: Many bacterial virulence factors require disulfide bonds for structural stability and function. DsbB, through its role in maintaining DsbA in an oxidized state, would be essential for the proper folding of these factors.

  • Specific H. somnus virulence proteins: H. somnus produces immunoglobulin binding proteins (IgBPs), including high-molecular-weight (HMW) IgBPs and the 76-kDa surface protein (p76), which are associated with serum resistance and virulence . These proteins may require disulfide bonds for proper folding and function.

  • Surface structure formation: Virulent H. somnus strains possess a surface fibrillar network with IgG2 binding activity . The formation and stability of this network might depend on proper disulfide bond formation catalyzed by the DsbA/DsbB system.

In experimental bovine respiratory tract disease models, H. somnus causes necrotizing, suppurative lobular bronchopneumonia and pleuritis , potentially through virulence factors that depend on proper disulfide bond formation.

How do environmental conditions affect H. somnus DsbB function?

Environmental conditions significantly impact DsbB function through several mechanisms:

  • Oxygen availability:

    • Under aerobic conditions, DsbB passes electrons to ubiquinone

    • Under anaerobic conditions, menaquinone serves as the electron acceptor

    • This flexibility allows disulfide bond formation to continue regardless of oxygen levels

  • Redox environment:

    • Exposure to reducing agents can impair DsbB function

    • Oxidative stress may enhance activity but potentially cause non-specific disulfide formation

  • pH and ionic conditions:

    • These factors affect the redox potential of the catalytic cysteines

    • Optimal function likely occurs at physiological pH (6-7) found in the host environment

These environmental adaptations are particularly relevant for pathogens like H. somnus that must function in diverse host microenvironments during infection .

How can structural studies of H. somnus DsbB inform antimicrobial development?

Structural studies of H. somnus DsbB could reveal several potential targets for antimicrobial development:

  • Quinone binding site: This site is essential for DsbB function and differs from human proteins, making it an attractive target for selective inhibition. Small molecules that compete with quinone binding could block electron transfer and disrupt disulfide bond formation.

  • DsbA-DsbB interaction interface: Compounds that disrupt this critical protein-protein interaction could effectively block the entire oxidative folding pathway.

  • Transmembrane region: Molecules that destabilize membrane insertion or disrupt conformational changes could inhibit function.

Since many virulence factors in H. somnus depend on proper disulfide bond formation, inhibitors of DsbB could potentially attenuate virulence without directly killing bacteria, potentially reducing selection pressure for resistance development .

What are the challenges in developing in vitro assays for H. somnus DsbB activity?

Developing robust in vitro assays for H. somnus DsbB activity presents several technical challenges:

  • Membrane protein stability:

    • Maintaining native conformation outside the membrane environment

    • Finding suitable detergents or membrane mimetics

    • Preventing aggregation during storage and assays

  • Coupled enzyme systems:

    • Reconstituting the DsbA-DsbB electron transfer pathway

    • Selecting appropriate electron acceptors (quinones)

    • Developing sensitive detection methods for disulfide formation

  • Physiological relevance:

    • Ensuring in vitro conditions reflect the in vivo environment

    • Correlating biochemical activity with biological function

    • Accounting for potential regulatory factors present in vivo

Despite these challenges, recent advances in membrane protein biochemistry provide promising approaches, including nanodiscs, amphipols, and fluorescence-based redox sensors that can facilitate these studies .

How might H. somnus DsbB function be targeted in vaccine development strategies?

H. somnus DsbB could inform vaccine development through several strategies:

  • Direct targeting:

    • Though DsbB itself is not an ideal vaccine antigen due to limited surface exposure, understanding its role in virulence factor maturation is valuable

    • Identifying DsbB-dependent surface antigens for vaccine development

  • Attenuated vaccine strains:

    • Modified DsbB function could create attenuated strains with reduced virulence but retained immunogenicity

    • Temperature-sensitive DsbB mutants could provide self-limiting vaccine candidates

  • Subunit vaccine components:

    • DsbB-dependent outer membrane proteins or secreted factors as vaccine antigens

    • Focus on immunoglobulin binding proteins (IgBPs) that depend on disulfide bonds for stability

Studies have demonstrated that vaccination with immunoglobulin binding proteins of H. somnus can provide protection against intrabronchial challenge. Specifically, calves immunized with the GST-IbpA3 peptide fragment (amino acids 972-1515) showed protection in preliminary studies .

How does H. somnus DsbB compare structurally and functionally to E. coli DsbB?

While specific structural data for H. somnus DsbB is limited, comparative analysis with the well-characterized E. coli DsbB provides valuable insights:

FeatureE. coli DsbBPredicted H. somnus DsbBFunctional Significance
Transmembrane domains4Likely 4Essential for membrane anchoring and quinone interaction
Periplasmic loops2 with catalytic cysteinesLikely conservedCritical for DsbA interaction and electron transfer
Cysteine pairsCys41/44 and Cys104/130Likely conserved positionsEssential for catalytic activity
Quinone interactionQ loop between TM1-TM2Likely conservedElectron transfer to respiratory chain
DsbA specificityHigh specificityMay have species-specific adaptationsDetermines efficiency of the oxidative pathway

These structural similarities would suggest a conserved catalytic mechanism, though species-specific variations might reflect adaptation to different ecological niches or host environments .

What insights do comparative genomic studies provide about DsbB evolution and adaptation?

Comparative genomic studies of DsbB across bacterial species reveal several important insights:

  • Conservation patterns:

    • Core catalytic elements (cysteine pairs) are highly conserved

    • Transmembrane topology is preserved across diverse species

    • Species-specific variations occur primarily in non-catalytic regions

  • Genomic context:

    • Variable organization of dsb genes across bacterial phyla

    • Co-evolution with specific DsbA variants

    • Association with particular sets of virulence genes in pathogens

  • Adaptive significance:

    • Environmental niche-specific adaptations

    • Host-specific variations in pathogens

    • Correlation with bacterial lifestyle (pathogenic vs. commensal)

These evolutionary insights help identify conserved functional elements that are essential for activity versus adaptable regions that may confer species-specific properties .

How does the H. somnus Dsb system integrate with other bacterial redox systems?

The H. somnus Dsb system likely integrates with other bacterial redox systems through several mechanisms:

  • Respiratory chain connection:

    • DsbB transfers electrons to quinones that feed into the respiratory chain

    • This creates a link between protein folding and energy generation

    • Environmental conditions affecting respiration would influence disulfide bond formation

  • Interaction with isomerization pathway:

    • In E. coli, the oxidation pathway (DsbA/DsbB) functions alongside the isomerization pathway (DsbC/DsbD)

    • These pathways are generally kept separate to prevent futile cycles

    • H. somnus likely maintains similar pathway separation

  • Stress response integration:

    • Redox stress response systems may modulate Dsb activity

    • Changes in periplasmic redox conditions during infection could affect pathway balance

    • Adaptation to host defense mechanisms like oxidative burst

This integration ensures that disulfide bond formation responds appropriately to changing environmental conditions during host colonization and infection .

What role might H. somnus DsbB play in attenuated vaccine development for bovine respiratory disease?

H. somnus DsbB could contribute to vaccine development strategies for bovine respiratory disease through several approaches:

  • Attenuated strain development:

    • Controlled modification of DsbB function could create strains with reduced virulence

    • Such strains would potentially retain immunogenicity while limiting pathogenic potential

    • Temperature-sensitive mutants could provide self-limiting vaccine candidates

  • Identification of vaccine antigens:

    • Understanding which virulence factors depend on DsbB for proper folding helps identify potential protective antigens

    • Focus on surface-exposed, DsbB-dependent proteins that elicit strong immune responses

  • Combination vaccines:

    • Integration with other approaches targeting H. somnus virulence

    • Potential synergy with vaccines against other bovine respiratory pathogens

Research has demonstrated that calves vaccinated against H. somnus show reduced risk of undifferentiated bovine respiratory disease, suggesting the feasibility of effective vaccine development . The immunoglobulin binding proteins of H. somnus, which may depend on proper disulfide bond formation, have shown promise as vaccine candidates in preliminary studies .

How can structural biology approaches advance our understanding of H. somnus DsbB?

Advanced structural biology techniques can significantly enhance our understanding of H. somnus DsbB:

  • Cryo-electron microscopy (cryo-EM):

    • Allows visualization of membrane proteins without crystallization

    • Can capture different conformational states during the catalytic cycle

    • Provides insights into membrane embedding and protein-protein interactions

  • X-ray crystallography:

    • High-resolution structural details of binding sites and catalytic centers

    • Comparison with known DsbB structures from other bacteria

    • Co-crystallization with interaction partners or inhibitors

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps dynamics and conformational changes during catalysis

    • Identifies regions involved in protein-protein interactions

    • Provides information about solvent accessibility and structural flexibility

These structural insights would facilitate rational drug design targeting DsbB and advance our understanding of the molecular mechanisms of disulfide bond formation .

What new methodological approaches could overcome current limitations in studying H. somnus DsbB?

Several innovative approaches could address current limitations in studying H. somnus DsbB:

  • Membrane mimetic systems:

    • Nanodiscs provide a defined lipid environment with improved stability

    • Styrene-maleic acid copolymer lipid particles (SMALPs) allow extraction without detergents

    • Microfluidic platforms for high-throughput screening of conditions

  • Advanced genetic tools:

    • CRISPR-Cas9 for precise genomic editing in H. somnus

    • Conditional expression systems for essential genes

    • Fluorescent reporters for real-time monitoring of disulfide bond formation

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Optical tweezers to study protein-protein interactions

    • Super-resolution microscopy to visualize DsbB localization in bacterial cells

These approaches would overcome limitations of traditional biochemical methods and provide new insights into the dynamics and regulation of DsbB function in its native context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.