Recombinant Haemophilus somnus Large-conductance mechanosensitive channel (mscL)

What is the molecular structure of Haemophilus somnus mscL protein?

The Haemophilus somnus Large-conductance mechanosensitive channel (mscL) is a full-length protein consisting of 131 amino acids (1-131aa). The protein contains multiple structural elements including transmembrane helices that are critical for its mechanosensitive properties. The amino acid sequence is: MSFIKEFREFAMRGNVIDMAVGVIIGGAFGKIVSSLVADVIMPILSFFTSSVDFKDLHIVLKEATDKTPAMTLKYGMFIQNIFDFIIIAFAIFLMIKALNKLKKEEPKVEKVITPSNEEKLLTEIRDLLKK . This structure shares homology with other bacterial mscL proteins, particularly with the well-characterized Escherichia coli mscL, though with distinct species-specific variations that may affect functional properties.

How does the Haemophilus somnus mscL channel function as a mechanosensor?

The Haemophilus somnus mscL functions as a pressure-relief valve protecting the bacterial cell from lysis during acute osmotic downshock. When membrane tension increases due to osmotic pressure changes, the channel undergoes conformational rearrangements in its transmembrane helices, opening a nonselective pore approximately 30 Å wide with a large unitary conductance of ~3 nS . This mechanosensation process involves coordinated movements between different domains of the channel, with significant changes in the tilt angles of the two transmembrane helices (TM1 and TM2) . The helix-pivoting model explains how mechanical force from membrane tension is transduced into channel opening, allowing rapid ion and small molecule efflux to relieve cellular pressure.

What expression systems are most effective for producing recombinant Haemophilus somnus mscL?

For recombinant expression of Haemophilus somnus mscL, E. coli-based expression systems have proven most effective based on available research data . When expressing the full-length protein (1-131aa), adding an N-terminal His-tag facilitates subsequent purification while preserving protein functionality . The expression construct should be optimized for codon usage in E. coli, as Haemophilus codon preferences differ significantly. For improved yield and folding, consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3) or C43(DE3)). IPTG induction protocols should be optimized with reduced temperature (16-20°C) during the induction phase to minimize inclusion body formation and improve the yield of properly folded channel protein in the membrane fraction.

What is the optimal purification protocol for recombinant Haemophilus somnus mscL?

The optimal purification protocol for His-tagged Haemophilus somnus mscL begins with membrane fraction isolation followed by detergent solubilization. Based on recombinant protein production methods, the following protocol is recommended:

• Harvest E. coli cells expressing His-tagged mscL by centrifugation

• Lyse cells using either sonication or French press in buffer containing protease inhibitors

• Separate membrane fraction through ultracentrifugation (100,000×g for 1 hour)

• Solubilize membrane proteins using a mild detergent such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration

• Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

• Wash extensively with buffer containing reduced detergent concentration (0.1% DDM)

• Elute protein with imidazole gradient (50-500 mM)

• Further purify using size exclusion chromatography to ensure homogeneity

The purified protein should be maintained in buffer containing detergent above critical micelle concentration to prevent aggregation, and purity should exceed 90% as determined by SDS-PAGE .

How should recombinant Haemophilus somnus mscL be stored to maintain stability and functionality?

For optimal stability and functionality, recombinant Haemophilus somnus mscL should be stored according to the following guidelines:

• Short-term storage (up to one week): Store working aliquots at 4°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Long-term storage: Store at -20°C/-80°C with 5-50% glycerol (recommended final concentration of 50%)

• Avoid repeated freeze-thaw cycles as they cause protein denaturation and aggregation

• For lyophilized preparations, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use

• After reconstitution, aliquot into single-use volumes before freezing to avoid repeated thawing

Properly stored and handled recombinant mscL protein can maintain functionality for several months, though activity assays should be performed before critical experiments to confirm channel functionality.

What electrophysiological methods are most suitable for studying Haemophilus somnus mscL channel activity?

For studying Haemophilus somnus mscL channel activity, several electrophysiological approaches can be employed:

• Patch-clamp recording in reconstituted liposomes: This is the gold standard for single-channel analysis, allowing direct measurement of channel conductance (~3 nS), open probability, and gating kinetics in response to membrane tension applied through negative pressure . Use symmetrical KCl solutions (200-400 mM) and apply negative pressure in steps of 5-10 mmHg.

• Planar lipid bilayer recordings: This method permits controlled lipid composition, which is critical since mscL gating is sensitive to membrane thickness and composition. Incorporate purified protein at low density (protein:lipid ratio of 1:1000 or lower) to achieve single-channel recordings.

• Fluorescence-based flux assays: For higher-throughput analysis, reconstitute the channel into liposomes loaded with self-quenching fluorescent dyes (calcein or carboxyfluorescein). Channel opening upon hypoosmotic shock allows dye release, measured as increased fluorescence intensity.

For all methods, controlling membrane tension is crucial. Calibrate pressure application systems carefully and maintain consistent lipid compositions between experiments to ensure reproducibility.

How can researchers effectively reconstitute Haemophilus somnus mscL into artificial membrane systems?

Effective reconstitution of Haemophilus somnus mscL into artificial membranes requires careful consideration of lipid composition and reconstitution methodology:

• Lipid selection: Use E. coli total lipid extract or a defined mixture of phosphatidylethanolamine, phosphatidylglycerol, and cardiolipin (70:25:5 ratio) to mimic bacterial membrane composition.

• Detergent-mediated reconstitution:

  • Solubilize lipids in chloroform, dry under nitrogen, and rehydrate in buffer

  • Add DDM to form mixed micelles

  • Combine with purified mscL protein at desired protein:lipid ratio (1:200 to 1:2000)

  • Remove detergent using Bio-Beads SM-2 or dialysis against detergent-free buffer

  • Confirm reconstitution by freeze-fracture electron microscopy or dynamic light scattering

• Proteoliposome quality control:

  • Check size distribution using dynamic light scattering

  • Verify protein orientation using protease protection assays

  • Confirm functional reconstitution with osmotic shock-induced dye release assays

Controlling protein orientation is challenging but critical—aim for physiological orientation (cytoplasmic domain facing outside) by manipulating pH during reconstitution.

How do conformational changes in Haemophilus somnus mscL compare to those in other bacterial mscL homologs?

Conformational changes in Haemophilus somnus mscL likely follow similar principles to those observed in other bacterial mscL homologs, but with species-specific variations. Based on structural studies of archaeal MscL homologs:

• Transmembrane helix movements: The significant conformational rearrangements in TM1 and TM2 helices observed in archaeal MscL likely occur in Haemophilus somnus mscL, with changes in tilt angles following the helix-pivoting model . These movements are essential for pore formation during channel opening.

• Periplasmic loop transformations: In archaeal MscL, the periplasmic loop region transforms from a folded structure containing an ω-shape to an expanded conformation during channel opening . Similar transformations likely occur in Haemophilus somnus mscL, though the precise conformational changes may differ based on sequence variations.

• Species-specific variations: While the core mechanosensing mechanism is conserved, the sequence diversity (Haemophilus somnus mscL shows closer homology to E. coli than to archaeal homologs) suggests possible differences in:

  • Gating threshold sensitivity to membrane tension

  • Channel kinetics (opening and closing rates)

  • Interactions with lipid membrane components

To experimentally characterize these conformational changes, researchers should employ FRET-based approaches with strategically placed fluorophores or site-directed spin labeling combined with EPR spectroscopy to track distance changes during gating.

What are the potential applications of Haemophilus somnus mscL in antimicrobial development?

Haemophilus somnus mscL represents a potential target for novel antimicrobial strategies against this veterinary pathogen, which causes various disease syndromes in cattle including pneumonia and thromboembolic meningoencephalitis . Potential applications include:

• Channel activators as antimicrobials: Compounds that artificially activate mscL channels at normal osmotic pressure would cause inappropriate ion and metabolite leakage, disrupting cellular homeostasis. This approach could be particularly effective against Haemophilus somnus, which appears to have evolved virulence factors enabling it to transition from a commensal to a pathogen under stress conditions .

• Structure-based drug design: With the amino acid sequence now available , homology modeling based on solved MscL structures can guide the design of compounds that bind specifically to Haemophilus somnus mscL. Target unique pocket regions that differ from mammalian mechanosensitive channels to ensure selectivity.

• Combination therapy approaches: mscL-targeting compounds could potentiate traditional antibiotics by increasing membrane permeability. This synergistic approach might be particularly valuable against strains with reduced antibiotic susceptibility.

For drug development, focus on compounds that interact with the highly conserved pore-lining regions or the tension-sensing interfaces between transmembrane helices and membrane lipids.

How does Haemophilus somnus mscL contribute to bacterial survival during infection?

Haemophilus somnus mscL likely plays a critical role in bacterial survival during infection through several mechanisms:

• Osmotic stress protection: As Haemophilus somnus transitions between different microenvironments within the host (from upper respiratory tract to lung tissue or bloodstream), it encounters varying osmotic conditions. The mscL channel functions as a protective valve, preventing cell lysis during hypoosmotic shifts .

• Adaptation to host immune response: During infection, neutrophilic to fibrinoid vasculitis and other inflammatory responses create local osmotic fluctuations. The mscL channel helps the bacterium withstand these defense-induced environmental changes.

• Biofilm formation support: Histophilus somni (Haemophilus somnus) can form biofilms as part of its virulence strategy . The mscL channel may contribute to the osmotic regulation necessary during biofilm formation and maintenance, particularly in the transition from planktonic to biofilm growth.

• Potential role in antibiotic resistance: While not directly conferring resistance, the ability to rapidly respond to membrane stress through mscL may provide a survival advantage when exposed to membrane-active antimicrobials during treatment.

Experimental approaches to study these contributions include creating mscL knockout strains and assessing their survival under osmotic challenge conditions and within infection models.

What is the relationship between Haemophilus somnus mscL and other virulence factors in pathogenicity?

The relationship between Haemophilus somnus mscL and other virulence factors appears complex, forming part of an integrated stress response and virulence system:

• Outer membrane proteins (OMPs) interaction: Haemophilus somnus expresses OMPs that bind host immunoglobulins (IgGs) . The mscL channel likely coordinates with these proteins during osmotic stress to maintain membrane integrity while these virulence factors are active.

• Iron acquisition systems: Haemophilus somnus requires iron acquisition mechanisms for survival in the host . The mscL channel may help maintain cellular homeostasis during the expression and function of these iron uptake systems, which often involve significant membrane protein complexes.

• Phase variation mechanisms: Haemophilus somnus employs genetic phase variation to modify surface antigens and evade host immunity . The osmotic protection provided by mscL ensures bacterial survival during these surface remodeling processes, which may temporarily compromise membrane stability.

• Stress response coordination: During infection, mscL likely functions within a broader stress response network that includes mechanisms for adapting to oxidative stress, nutritional limitation, and immune attack—all conditions encountered during the transition from commensal to pathogen.

To experimentally investigate these relationships, researchers should employ transcriptomic and proteomic analyses comparing wild-type and mscL mutant strains under various stress conditions relevant to the host environment.

How does Haemophilus somnus mscL compare structurally and functionally to mscL proteins in other pathogenic bacteria?

Comparative analysis of Haemophilus somnus mscL with other bacterial homologs reveals important structural and functional relationships:

• Sequence homology: Haemophilus somnus mscL shows significant sequence conservation with other bacterial mechanosensitive channels. The full amino acid sequence exhibits characteristic features of bacterial mscL channels, including hydrophobic transmembrane regions and conserved pore-lining residues .

• Structural comparison table:

• Functional conservation: Despite sequence differences, the core mechanosensitive function appears conserved across bacterial species. The channel consistently acts as a pressure-relief valve during hypoosmotic shock, opening a large conductance pore when membrane tension increases . The helix-pivoting gating mechanism observed in archaeal homologs likely represents a universal feature of all mscL channels, including Haemophilus somnus mscL .

• Host adaptation: Species-specific variations in sequence may reflect adaptation to different host environments. As a pathogen primarily affecting cattle, Haemophilus somnus mscL may have evolved specific tension-sensing thresholds optimized for survival in bovine host environments, particularly the respiratory and reproductive tracts where it is commonly found .

What evolutionary insights can be gained from studying Haemophilus somnus mscL?

Studying Haemophilus somnus mscL offers several evolutionary insights:

• Conservation of mechanosensation mechanism: The presence of mscL in Haemophilus somnus, with predicted structural and functional similarities to other bacterial homologs, highlights the evolutionary conservation of this osmotic protection mechanism across diverse bacterial lineages. This conservation underscores the fundamental importance of mechanosensation for bacterial survival.

• Pathogen-specific adaptations: Comparative analysis between mscL proteins from commensal and pathogenic bacteria may reveal adaptations specific to the pathogenic lifestyle. Haemophilus somnus, which can transition from commensal to pathogen , represents an interesting model for studying how mechanosensitive channels may be optimized for different ecological niches within the host.

• Co-evolution with virulence factors: Examining the genetic context of the mscL gene within the Haemophilus somnus genome may reveal co-evolution with other virulence-related genes. Potential genetic linkage or coordinated expression with virulence factors would suggest integration of osmoregulation into the broader virulence strategy.

• Horizontal gene transfer assessment: Analyzing nucleotide composition, codon usage, and phylogenetic placement of mscL sequences can help determine if Haemophilus somnus acquired this gene through horizontal transfer or vertical inheritance, providing insights into the evolutionary history of this pathogen.

To experimentally approach these evolutionary questions, researchers should perform comprehensive phylogenetic analyses including diverse bacterial mscL sequences and correlate sequence variations with functional differences measured through electrophysiological methods.

What are the major challenges in expressing and purifying functional Haemophilus somnus mscL, and how can they be overcome?

Researchers face several significant challenges when working with Haemophilus somnus mscL:

• Membrane protein expression barriers:

  • Challenge: Low expression levels and protein misfolding

  • Solution: Use specialized expression strains such as C41(DE3), optimize induction conditions (reduced temperature at 20°C, lower IPTG concentration of 0.1-0.5 mM), and consider fusion partners like maltose-binding protein that can enhance solubility while maintaining function

• Detergent selection complexities:

  • Challenge: Finding detergents that efficiently extract mscL without denaturing it

  • Solution: Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations; consider using fluorescence-based thermal stability assays to identify conditions that yield the most stable protein

• Functional reconstitution difficulties:

  • Challenge: Achieving uniform orientation and distribution in artificial membranes

  • Solution: Implement rigorous quality control using freeze-fracture electron microscopy or AFM imaging; standardize reconstitution protocols with precise protein:lipid ratios and controlled detergent removal rates

• Protein quantification inaccuracies:

  • Challenge: Detergent interference with standard protein assays

  • Solution: Use amino acid analysis or quantitative amino acid labeling for absolute quantification; alternatively, develop standard curves using purified recombinant protein in the same detergent

• Storage stability issues:

  • Challenge: Activity loss during storage

  • Solution: Add stabilizing agents like trehalose (6%) and glycerol (up to 50%) ; store at -80°C in small single-use aliquots to avoid freeze-thaw cycles

For researchers new to this field, beginning with the established protocol for His-tagged recombinant protein provides a strong foundation that can be optimized for specific experimental requirements.

How can researchers effectively study the gating mechanism of Haemophilus somnus mscL?

Effective study of the Haemophilus somnus mscL gating mechanism requires a multidisciplinary approach:

• Site-directed mutagenesis strategy:

  • Create systematic mutations in predicted pore-lining residues and transmembrane helices

  • Focus on conserved residues identified through alignment with E. coli mscL and other characterized homologs

  • Analyze effects on channel conductance, pressure threshold, and kinetics

• Advanced structural biology approaches:

  • Apply cryo-electron microscopy to capture multiple conformational states

  • Use DEER-EPR spectroscopy with site-directed spin labeling to measure distance changes during gating

  • Implement molecular dynamics simulations based on homology models to predict conformational changes

• Membrane tension measurement and control:

  • Develop micropipette aspiration techniques for precise application of membrane tension

  • Utilize microfluidic platforms for high-throughput screening of channel responses to various tension levels

  • Combine with fluorescence imaging to correlate tension with gating events

• Lipid-protein interaction characterization:

  • Perform systematic reconstitution in membranes with varying lipid compositions

  • Measure gating parameters as a function of membrane thickness and lateral pressure profile

  • Use fluorescently labeled lipids to track redistribution during channel opening

• Integration with computational models:

  • Develop predictive models of tension transfer from lipid bilayer to protein

  • Simulate energy landscapes of the transition between closed and open states

  • Validate computational predictions with experimental measurements

This integrated approach allows researchers to connect structural changes with functional outcomes, ultimately building a comprehensive model of how Haemophilus somnus mscL transduces mechanical force into channel opening.

What are the most promising future research directions for Haemophilus somnus mscL?

The study of Haemophilus somnus mscL offers several promising research directions:

• Structure-function relationships: Obtain high-resolution structures of Haemophilus somnus mscL in multiple conformational states, similar to the approach used with archaeal MscL homologs . This would provide direct insights into the physical principles of mechanical coupling that coordinate the multiple structural elements during channel gating.

• Role in bacterial physiology and pathogenesis: Develop genetic tools to create mscL knockout strains in Haemophilus somnus to evaluate its contribution to osmotic stress resistance, biofilm formation, and virulence in animal models. This approach would clarify how mechanosensation contributes to the bacterium's ability to transition from commensal to pathogen.

• Antimicrobial development: Screen for compounds that specifically target Haemophilus somnus mscL, either activating the channel inappropriately (causing cellular leakage) or blocking its function (preventing osmotic protection). Such compounds could form the basis for novel veterinary antimicrobials against this cattle pathogen.

• Comparative mechanobiology: Perform systematic comparisons of mechanosensitive properties between mscL channels from diverse bacterial species to understand how evolutionary adaptations in channel structure correlate with specific bacterial lifestyles and host environments.

These research directions collectively contribute to our fundamental understanding of bacterial mechanosensation while potentially leading to practical applications in veterinary medicine and beyond.

How can integrated multi-omics approaches enhance our understanding of Haemophilus somnus mscL in the context of bacterial physiology?

Integrated multi-omics approaches offer powerful tools for contextualizing Haemophilus somnus mscL within broader bacterial physiological systems:

• Transcriptomics-proteomics integration:

  • Analyze transcriptional changes in response to osmotic challenges, comparing wild-type and mscL mutant strains

  • Correlate mRNA expression with protein levels to identify post-transcriptional regulation

  • Map osmotic stress response networks, positioning mscL within the broader cellular response system

• Structural-functional proteomics:

  • Identify interaction partners of mscL using proximity labeling approaches

  • Characterize post-translational modifications that might regulate channel function

  • Apply protein correlation profiling to determine subcellular localization patterns

• Lipidomics correlation:

  • Profile membrane lipid composition changes during osmotic adaptation

  • Correlate specific lipid species with mscL function and distribution

  • Identify lipid-protein interactions that modulate channel sensitivity

• Metabolomics integration:

  • Track metabolite flux during osmotic challenges in wild-type versus mscL mutants

  • Identify metabolic signatures associated with mscL activation

  • Correlate changes in small molecule concentrations with channel gating

• Systematic data integration framework:

  • Develop computational models that integrate multi-omics data

  • Apply machine learning approaches to identify patterns and predictive markers

  • Generate testable hypotheses about mscL regulation in complex physiological contexts