Recombinant Haemophilus somnus Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Haemophilus somnus Lipoprotein Signal Peptidase (lspA)

Recombinant Haemophilus somnus Lipoprotein signal peptidase (lspA) is a recombinant protein derived from the bacterium Haemophilus somnus, which is known for causing diseases in cattle. This enzyme plays a crucial role in the processing of lipoproteins, which are essential components of bacterial membranes. Lipoprotein signal peptidase II (lspA) is responsible for cleaving the signal peptide from prolipoproteins, allowing them to mature into functional lipoproteins .

Function and Importance of lspA

LspA is an aspartyl protease that relies on two catalytic aspartic acid residues to cleave the signal peptide of prolipoproteins. This process is vital for the maturation and localization of lipoproteins in Gram-negative bacteria, including Haemophilus somnus. The enzyme's activity is essential for bacterial survival and virulence, making it a potential target for antibiotic development .

Recombinant Expression of lspA

Recombinant Haemophilus somnus Lipoprotein signal peptidase (lspA) is typically expressed in Escherichia coli (E. coli), a common host for recombinant protein production. The recombinant protein can be fused with tags, such as a His-tag, to facilitate purification and detection .

Research Findings and Applications

Research on lspA has focused on its role in bacterial lipoprotein processing and its potential as a target for antibiotic development. Studies have shown that lspA is essential for the growth of certain bacteria, such as Helicobacter pylori, and that disrupting its function can inhibit bacterial survival . The conformational dynamics of lspA have been studied using molecular dynamics simulations and electron paramagnetic resonance, revealing a flexible active site that accommodates various substrates and antibiotics .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lspA; HSM_0051; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
lspA
Target Protein Sequence
MNLSKTGLPFLWISAVAFFTDLITKLAVVKNFSLYESVNILPFFNLTYVRNHGAAFSFLA DHAGWQKYFFILLALAVSFMILFFLYKNQATQKLQNTGYALMIGGALANAADRAYHGFVV DFFDFYWQQWHYPVFNVADIAICIGAGLLAIDAFKQNDKKESKQN
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: hsm:HSM_0051

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus Lipoprotein signal peptidase (lspA) and what is its biological function?

Haemophilus somnus (now reclassified as Histophilus somni) Lipoprotein signal peptidase (lspA) is a critical enzyme involved in the processing of bacterial lipoproteins. It functions as a signal peptidase II (SPase II) that cleaves the signal peptide from prolipoprotein precursors during their maturation pathway. The enzyme recognizes the consensus cleavage sequence in bacterial lipoproteins and is essential for proper lipoprotein processing and localization to the bacterial cell envelope. In H. somnus, which is a facultative intracellular pathogen causing a wide range of diseases in cattle, lspA plays a crucial role in bacterial viability and potentially in virulence .

What are the optimal expression systems for recombinant lspA production?

The most effective expression system for recombinant H. somnus lspA is E. coli. When designing expression constructs, researchers should consider:

  • Vector selection: pET-based expression systems offer high-level expression under the control of T7 promoter

  • Strain optimization: BL21(DE3) or its derivatives are recommended for membrane protein expression

  • Induction conditions: Lower temperatures (16-25°C) after induction can enhance proper folding

  • Fusion tags: N-terminal His-tag allows for efficient purification while maintaining enzymatic activity

Expression in mammalian or insect cell systems is generally not necessary for basic functional studies of lspA.

How should recombinant lspA be stored to maintain stability?

For optimal stability of recombinant lspA:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, prepare working aliquots with 5-50% glycerol (final concentration)

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles which can significantly reduce enzyme activity

When reconstituting, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. A buffer system based on Tris/PBS with 6% Trehalose at pH 8.0 provides optimal stability for the reconstituted protein .

What are the recommended approaches for assessing lspA enzymatic activity?

To evaluate the enzymatic activity of recombinant lspA, researchers can employ the following methods:

MethodPrincipleAdvantagesLimitations
Globomycin inhibition assayMeasures enzymatic activity by monitoring its inhibition by globomycinDirect assessment of native functionRequires access to globomycin
Fluorogenic substrate assayUses synthetic peptides with fluorescent tags that become detectable upon cleavageHigh sensitivity, quantitativeMay not fully represent native substrate interactions
In vivo complementationExpression of recombinant lspA in conditional lspA mutantsDemonstrates biological functionalityRequires genetic manipulation of host organisms
Mass spectrometryDetects processed vs. unprocessed lipoproteinsPrecise molecular characterizationComplex data analysis, expensive

The inhibition of lspA by globomycin, a specific inhibitor of signal peptidase II, provides a valuable control to confirm the specificity of enzymatic activity measurements .

How can researchers study the interaction between lspA and its lipoprotein substrates?

To investigate lspA-substrate interactions, consider these approaches:

  • Co-immunoprecipitation studies: Using anti-lspA antibodies to pull down enzyme-substrate complexes

  • Surface plasmon resonance: Measuring binding kinetics between purified lspA and synthetic peptide substrates

  • Crosslinking experiments: Capturing transient enzyme-substrate interactions using chemical crosslinkers

  • Site-directed mutagenesis: Modifying the consensus cleavage site (Leu-Ala-Ala-Cys) in substrate proteins to evaluate recognition specificity

Remember that proper experimental design should include appropriate controls, such as comparing wild-type lspA with catalytically inactive mutants.

How does lspA contribute to H. somnus virulence?

The contribution of lspA to H. somnus virulence involves multiple mechanisms:

  • Lipoprotein processing: LspA processes outer membrane lipoproteins that may function as adhesins, immunomodulators, or nutrient acquisition factors

  • Cell envelope integrity: Proper lipoprotein processing is essential for maintaining cell envelope structure and function

  • Host immune evasion: Processed lipoproteins may contribute to immune evasion strategies

Research indicates that LspA processes virulence-associated lipoproteins such as LppB, which has been localized to the outer membrane of H. somnus. The LppB lipoprotein exhibits seroreactivity with bovine hyperimmune sera, suggesting it is expressed during infection and potentially recognized by the host immune system .

What animal models are appropriate for studying lspA's role in pathogenesis?

Based on available research, the following animal models are suitable for studying lspA's role in H. somnus pathogenesis:

  • Mouse septicemia model: This model has been successfully used to study H. somnus septicemia and evaluate vaccine components. Preincubation of H. somnus in fetal calf serum enhances virulence for mice by binding bovine transferrin, simulating bovine septicemia more closely .

  • Bovine respiratory disease model: As the natural host, cattle provide the most relevant model for studying H. somnus pathogenesis, though this requires specialized facilities.

When designing animal experiments, researchers should consider:

  • Appropriate controls (e.g., comparing wild-type strains with lspA mutants)

  • Ethical considerations and experimental endpoints

  • Sample size calculations to ensure statistical power

  • Comprehensive analysis of multiple parameters (bacterial load, inflammatory markers, etc.)

How can structural studies of lspA inform inhibitor development?

Structural studies of lspA can provide critical insights for developing specific inhibitors through:

  • X-ray crystallography or cryo-EM: To determine the three-dimensional structure of lspA, particularly in complex with substrates or known inhibitors like globomycin

  • Molecular docking: To identify potential binding sites for novel inhibitors

  • Structure-activity relationship (SAR) studies: To optimize lead compounds based on structural information

  • Fragment-based drug discovery: To identify small molecules that bind to catalytic or allosteric sites

Understanding the structural basis of lspA's catalytic mechanism could lead to the development of novel antimicrobials targeting H. somnus and related pathogens.

What methodologies can be used to evaluate lspA as a potential vaccine component?

Based on vaccination studies with related H. somnus components, researchers can evaluate lspA as a vaccine candidate using:

  • Recombinant subunit approach: Express and purify specific domains of lspA for immunization studies

  • Adjuvant optimization: Test various adjuvants to enhance immune responses against lspA

  • Challenge models: Assess protection against H. somnus challenge in appropriate animal models

  • Immune correlates analysis: Measure antibody titers, T-cell responses, and other immune parameters

Previous studies have demonstrated that both live H. somnus (convalescent immunity) and culture supernatant containing IbpA shed from the bacterial surface protected mice against septicemia, while formalin-killed H. somnus did not provide protection . Similar approaches could be applied to evaluate lspA-based vaccine components.

How can researchers address poor expression or insolubility of recombinant lspA?

When encountering expression or solubility issues:

  • Optimize expression conditions:

    • Reduce induction temperature (16-20°C)

    • Decrease inducer concentration

    • Extend expression time at lower temperatures

  • Modify construct design:

    • Try different fusion tags (MBP, SUMO, etc.)

    • Express individual domains rather than full-length protein

    • Remove potential aggregation-prone regions

  • Use specialized E. coli strains:

    • C41(DE3) or C43(DE3) for membrane proteins

    • Rosetta for rare codon optimization

    • SHuffle for disulfide bond formation

  • Optimize purification conditions:

    • Include mild detergents (0.1% DDM or LDAO)

    • Use higher salt concentrations (300-500 mM NaCl)

    • Adjust buffer pH and composition

How should researchers interpret contradictory results regarding lspA activity?

When facing contradictory results:

  • Verify protein integrity: Confirm proper folding and absence of degradation through gel filtration chromatography and Western blotting

  • Assess experimental conditions: Enzymatic activity might be affected by:

    • Buffer composition and pH

    • Presence of divalent cations

    • Detergent concentration

    • Substrate specificity differences

  • Consider biological context: Results from different experimental systems (in vitro vs. in vivo, different expression hosts) may reflect biological realities rather than experimental artifacts

  • Examine methodological differences: Different activity assays may measure different aspects of enzymatic function

What emerging technologies could advance lspA research?

Several cutting-edge technologies show promise for advancing lspA research:

  • CRISPR-Cas9 genome editing: For creating precise mutations in lspA or its substrates in H. somnus

  • Single-molecule enzymology: To study the kinetics and conformational changes during catalysis

  • Cryo-electron microscopy: For structural determination of lspA in its native membrane environment

  • Computational approaches: For in silico design of lspA inhibitors and prediction of substrate specificity

  • Multi-omics integration: Combining proteomics, transcriptomics, and metabolomics to understand lspA's role in bacterial physiology

How might lspA research contribute to broader understanding of bacterial pathogenesis?

Research on H. somnus lspA has implications beyond this specific pathogen:

  • Comparative analysis: Understanding the conservation and divergence of lipoprotein processing systems across bacterial species

  • Host-pathogen interactions: Elucidating how bacterial lipoproteins interact with host immune receptors

  • Antimicrobial development: Identifying new targets for broad-spectrum antibiotics

  • Vaccine technology: Developing improved adjuvants or delivery systems for bacterial antigens

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.