Recombinant Haemophilus somnus Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Production and Purification

rNqrE is typically overexpressed in E. coli, though optimization strategies vary:

  • Expression Strains: While E. coli BL21, C43, and R. gami show low yields, E. coli C41 demonstrates high overexpression under autoinduction or IPTG-induced conditions .

  • Localization: rNqrE partitions into both cytoplasmic soluble and insoluble fractions, with higher insoluble yields via autoinduction .

  • Purity: Commercial preparations exceed 90% purity, validated by SDS-PAGE .

Functional Role in Na(+)-NQR Complex

The Na(+)-NQR complex is a six-subunit respiratory enzyme (NqrA–F). rNqrE contributes to:

FunctionMechanism
Electron TransportTransfers electrons from NADH to ubiquinone via FAD and Fe-S cofactors .
Sodium TranslocationGenerates a Na+ gradient for ATP synthesis and nutrient uptake .
Pathogenic RelevanceCritical for H. somnus survival; potential antibiotic target .

Subunit E (NqrE) interacts with membrane-bound subunits (e.g., NqrD) and likely stabilizes cofactors like flavin mononucleotide (FMN) .

Research Applications

  1. Antibiotic Development: NQR’s role in ion gradient generation makes it a target for disrupting bacterial energetics .

  2. Structural Studies: Used in crystallography or cryo-EM to map Na(+)-NQR architecture .

  3. Cross-Reactivity Assays: Anti-rNqrE antibodies may detect homologous proteins in Pasteurellaceae and Enterobacteriaceae .

Limitations and Future Directions

  • Immunogenicity: Current data lack evidence of rNqrE-induced protective immunity in animal models.

  • Structural Variability: Amino acid substitutions at positions 2, 304, and 328 compared to reference sequences may affect function .

  • Host Optimization: Strain-specific expression challenges require further optimization for industrial-scale production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; HSM_1843; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGISVPVNQLVY SLILKDGALIDGVDLSFLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESIVYGIGAGTGWMLAIVALAGITEKMKYADVPAGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two successive reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: hsm:HSM_1843

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus Na(+)-translocating NADH-quinone reductase subunit E and what is its role in bacterial metabolism?

Na(+)-translocating NADH-quinone reductase (NQR) is a membrane-bound respiratory complex in many bacteria that couples the oxidation of NADH to the translocation of sodium ions across the membrane. In Haemophilus somnus (now commonly referred to as Histophilus somni), this enzyme plays a crucial role in energy metabolism and membrane potential generation.

For experimental studies, researchers typically express this protein recombinantly using expression systems similar to those used for other H. somni proteins, such as the pET expression system in E. coli strains optimized for membrane protein expression .

How does recombinant H. somnus Na(+)-translocating NADH-quinone reductase compare to other bacterial respiratory enzymes?

Bacterial respiratory enzymes show considerable diversity across species, with Na(+)-translocating NADH-quinone reductase representing one class of energy-coupling enzymes. While H. somnus NQR shares functional similarities with other bacterial respiratory complexes, it has distinct structural features.

Comparative analysis with similar proteins from other bacterial species reveals:

OrganismRespiratory ComplexIon TranslocatedSubunit CompositionEvolutionary Relationship
H. somnusNa(+)-NQRNa+Six subunits (A-F)Member of Pasteurellaceae family
E. coliNADH:ubiquinone oxidoreductase (Complex I)H+13-14 subunitsDistant evolutionary relationship
P. multocidaNa(+)-NQRNa+Six subunitsClose evolutionary relationship

Research approaches for studying these enzymes typically involve recombinant expression, purification in the presence of detergents or membrane mimetics, and functional assays measuring electron transfer activity and ion translocation.

What are the optimal expression systems for producing recombinant H. somnus proteins?

Based on research with other H. somnus proteins, several expression systems have proven effective, with E. coli being the most commonly utilized. For membrane proteins like Na(+)-NQR subunits, specialized strains designed for membrane protein expression yield better results.

From published research on H. somnus proteins:

The pET expression system with E. coli C41 strain has demonstrated high-level expression of H. somnus membrane proteins. This strain is specifically designed for expressing toxic transmembrane proteins . For Na(+)-NQR subunit E, which likely has membrane-associated properties, this system would be appropriate.

Methodology recommendations include:

  • Using auto-induction systems rather than IPTG induction for higher protein yields

  • Expression at lower temperatures (room temperature rather than 37°C) to enhance proper folding

  • Addition of 10% glycerol to buffers to maintain solubility of membrane-associated proteins

  • Careful fractionation of bacterial cells to identify optimal localization (soluble cytoplasmic, insoluble cytoplasmic, or periplasmic fractions)

What are the optimal conditions for expressing and purifying recombinant H. somnus Na(+)-translocating NADH-quinone reductase subunit E?

Based on studies with other H. somnus recombinant proteins, the following methodology is recommended:

Optimal Expression Conditions:

  • Expression Strain: E. coli C41, which has shown superior results for potentially toxic membrane proteins from H. somnus

  • Expression System: Auto-induction system rather than IPTG induction for higher yields

  • Temperature: Extended expression (16 hours) at room temperature rather than short expression at 37°C

  • Medium Supplements: Consider adding rare codon tRNAs if the gene contains rare codons

Purification Strategy:

  • Cell lysis under gentle conditions (avoid harsh detergents for initial steps)

  • Fractionation to determine protein localization (soluble cytoplasmic, insoluble cytoplasmic, or membrane fractions)

  • For membrane-associated proteins, inclusion of 10% glycerol in buffers to maintain solubility

  • Purification via affinity chromatography (His-tag methods work well for H. somnus recombinant proteins)

  • Consider size exclusion chromatography as a polishing step

Research has shown that many H. somnus membrane proteins can form inclusion bodies, which may actually be advantageous for purification as the toxic protein does not inhibit cell growth when present in an inactive form .

How can recombinant H. somnus proteins be validated for structural and functional integrity?

For proper validation of recombinant H. somnus proteins including Na(+)-translocating NADH-quinone reductase subunit E, a multi-faceted approach is recommended:

Structural Validation:

  • SDS-PAGE Analysis: Confirm expected molecular weight and purity

  • Western Blotting: Using either anti-His tag antibodies (if His-tagged) or specific antibodies against the protein if available

  • Mass Spectrometry: For accurate mass determination and peptide mapping

  • Circular Dichroism: To assess secondary structure elements

  • Thermal Shift Assays: To evaluate protein stability

Functional Validation:

  • Enzymatic Activity Assays: For Na(+)-NQR, measure NADH oxidation coupled to quinone reduction

  • Sodium Transport Assays: Using fluorescent sodium indicators or radioactive sodium

  • Reconstitution in Liposomes: To assess membrane incorporation and function

For H. somnus proteins, researchers have successfully employed Western blotting for structural validation and various immunological assays for functional validation .

What immunological properties have been observed in recombinant H. somnus proteins, and how might they apply to Na(+)-translocating NADH-quinone reductase?

Studies on recombinant H. somnus proteins have revealed significant immunogenic properties that could be relevant when studying Na(+)-translocating NADH-quinone reductase subunit E:

Research with recombinant H. somni OMP40 demonstrated:

  • Induction of a strong humoral immune response in cattle after immunization

  • Significant increases in IgG1 (P ≤ 0.01) and IgG2 (P ≤ 0.01) antibodies after immunization

  • Cross-reactivity with antigens from other gram-negative pathogens including Pasteurellaceae and Enterobacteriaceae families

  • Induction of delayed-type hypersensitivity reactions

For Na(+)-NQR subunit E, similar immunological studies could be conducted, particularly examining:

  • Antibody response profiles following immunization

  • Cross-reactivity with similar proteins from other bacterial species

  • T-cell responses to epitopes within the protein

  • Potential for inclusion in subunit vaccine formulations

The broad cross-reactivity observed with other H. somnus proteins suggests that conserved epitopes exist across related bacterial species, which may also be present in Na(+)-NQR subunits .

What cloning strategies are most effective for recombinant H. somnus protein expression?

Based on successful approaches with other H. somnus proteins, the following methodology is recommended:

Gene Amplification:

  • Design primers with appropriate restriction enzyme sites for directional cloning

  • For Na(+)-NQR subunit E, include additional nucleotides to ensure in-frame expression if necessary

  • Optimize PCR conditions, potentially including additives like DMSO (2%) to improve amplification efficiency

Recommended PCR Protocol:

  • Initial denaturation: 10 minutes at 94°C

  • 30 cycles: 15 seconds at 94°C, 30 seconds of annealing at 52°C, 90 seconds at 68°C

  • Final extension: 10 minutes at 68°C

Expression Vector Selection:

  • pET series vectors (particularly pET-22b(+) or pET-28a(+)) have proven effective

  • Include appropriate tags (His-tag is commonly used) for purification

  • Consider periplasmic targeting sequences for potential improved folding

Host Strain Selection:

  • E. coli C41 strain for membrane or toxic proteins

  • Consider Origami or similar strains for proteins requiring disulfide bond formation

This approach has been validated for multiple H. somnus proteins, including membrane proteins similar to Na(+)-NQR subunits .

What analytical techniques are most informative for studying structure-function relationships in bacterial respiratory enzymes like Na(+)-NQR?

Understanding structure-function relationships in complex respiratory enzymes requires a combination of techniques:

Structural Analysis:

  • X-ray Crystallography: Gold standard for high-resolution structures, though challenging for membrane proteins

  • Cryo-Electron Microscopy: Increasingly powerful for membrane protein complexes without crystallization

  • Small-Angle X-ray Scattering (SAXS): For low-resolution structural information in solution

  • Nuclear Magnetic Resonance (NMR): For dynamic studies and specific interactions

Functional Analysis:

  • Site-Directed Mutagenesis: To identify critical residues for catalysis or ion transport

  • Electron Paramagnetic Resonance (EPR): To study cofactor environments and electron transfer pathways

  • Potentiometric Titrations: To determine redox properties of cofactors

  • Ion Flux Measurements: Using ion-specific electrodes or fluorescent indicators

Computational Approaches:

  • Molecular Dynamics Simulations: To study conformational changes during catalysis

  • Homology Modeling: To predict structure based on related proteins with known structures

  • Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations: For studying electron transfer mechanisms

For H. somnus Na(+)-NQR specifically, comparative analysis with better-characterized NQR complexes from other bacteria would provide valuable insights into conserved structural and functional features.

What are common challenges in expressing membrane proteins like Na(+)-NQR subunits and how can they be addressed?

Membrane proteins present unique challenges in recombinant expression and purification:

Challenge 1: Toxicity to host cells

  • Solution: Use specialized strains like E. coli C41 designed for toxic membrane proteins

  • Solution: Use tightly controlled induction systems or auto-induction for gradual expression

Challenge 2: Protein misfolding and inclusion body formation

  • Solution: Lower expression temperature (room temperature or 16°C)

  • Solution: Consider fusion partners that enhance solubility

  • Solution: For H. somnus membrane proteins, inclusion bodies may actually be advantageous for purification and subsequent refolding

Challenge 3: Maintaining protein solubility during purification

  • Solution: Include appropriate detergents or lipid mimetics

  • Solution: Addition of 10% glycerol has proven effective for H. somnus membrane proteins

  • Solution: Optimize buffer conditions (pH, salt concentration)

Challenge 4: Assessing proper folding and function

  • Solution: Develop activity assays specific to the protein's function

  • Solution: Use circular dichroism or fluorescence spectroscopy to monitor structural integrity

  • Solution: Reconstitute purified protein into liposomes to assess membrane incorporation and function

Research with H. somnus membrane proteins has shown that using E. coli C41 with auto-induction provides optimal results, and that proper buffer formulation with glycerol is critical for maintaining solubility .

How does H. somnus Na(+)-translocating NADH-quinone reductase compare to similar enzymes in other bacterial pathogens relevant to Bovine Respiratory Disease?

Bovine Respiratory Disease (BRD) involves multiple bacterial pathogens, each with their own respiratory enzymes. Comparative analysis reveals:

PathogenRespiratory ComplexRole in PathogenesisPotential as Vaccine Target
H. somnusNa(+)-NQREnergy metabolism, potential virulence factorUnder investigation
M. haemolyticaVarious respiratory enzymesEnergy production during infectionLess studied than outer membrane proteins
P. multocidaNa(+)-NQR and other complexesMetabolic adaptation during infectionPotential target for cross-protective vaccines

While outer membrane proteins (OMPs) like OMP40, p31, and LppB have been the primary focus of vaccine development against H. somnus , respiratory enzymes like Na(+)-NQR represent an understudied class of potential targets.

The cross-reactivity observed with antibodies against H. somnus OMPs suggests that conserved epitopes exist across different bacterial species involved in BRD , which warrants investigation of whether similar cross-reactivity exists for Na(+)-NQR components.

What is the potential for H. somnus Na(+)-translocating NADH-quinone reductase subunits in vaccine development?

Vaccine development using H. sommus proteins has focused primarily on outer membrane proteins, but respiratory enzymes like Na(+)-NQR merit consideration:

Potential advantages of Na(+)-NQR as a vaccine target:

  • Essential for bacterial energy metabolism, making resistance mutations less likely

  • Potentially conserved epitopes across bacterial species

  • Membrane-associated, potentially accessible to antibodies

  • Part of a multi-subunit complex that may provide multiple antigenic determinants

Research with recombinant H. somni OMPs has demonstrated significant immunogenic properties, including:

  • Strong antibody responses in cattle with IgG1 and IgG2 production

  • Cross-reactivity with other gram-negative pathogens

  • Delayed-type hypersensitivity reactions indicating cell-mediated immunity

For Na(+)-NQR subunits, similar immunological studies could determine whether they elicit protective immune responses. The successful expression and purification methods established for other H. somni recombinant proteins could be applied to Na(+)-NQR subunits for vaccine development .

Current experimental vaccine approaches for BRD include combinations of recombinant proteins from multiple pathogens, such as LktA from M. haemolytica combined with p31 and LppB from H. somni , suggesting that Na(+)-NQR subunits could potentially be incorporated into such multi-component vaccines.

What are promising research avenues for further characterization of H. somnus Na(+)-translocating NADH-quinone reductase?

Several promising research directions would advance our understanding of this complex:

Structural Biology Approaches:

  • Cryo-EM studies of the complete NQR complex from H. somnus

  • X-ray crystallography of individual subunits, including subunit E

  • Hydrogen-deuterium exchange mass spectrometry to map subunit interactions

Functional Studies:

  • Reconstitution of the complete complex in proteoliposomes

  • Electrophysiological measurements of sodium transport

  • Identification of specific inhibitors as potential antimicrobial compounds

Genetic Approaches:

  • Gene knockouts or CRISPR interference to assess essentiality in H. somnus

  • Site-directed mutagenesis to identify critical residues

  • Suppressor mutation studies to understand protein-protein interactions within the complex

Immunological Studies:

  • Epitope mapping of each subunit including subunit E

  • Assessment of protective efficacy of antibodies against NQR in infection models

  • Combination with other antigens in experimental vaccine formulations

These studies would provide valuable insights not only for basic understanding of bacterial bioenergetics but also for potential applications in vaccine development and antimicrobial discovery.

How might advances in structural biology techniques impact the study of complex membrane proteins like Na(+)-NQR?

Recent advances in structural biology offer exciting opportunities for studying complex membrane proteins like Na(+)-NQR:

Cryo-Electron Microscopy (Cryo-EM):
The "resolution revolution" in cryo-EM has transformed membrane protein structural biology, now capable of near-atomic resolution without crystallization. For multi-subunit complexes like Na(+)-NQR, cryo-EM is particularly powerful for determining the complete structure and subunit arrangement.

Integrative Structural Biology:
Combining multiple techniques (X-ray crystallography, NMR, cryo-EM, mass spectrometry, computational modeling) provides complementary information. For Na(+)-NQR, this approach could reveal both static structure and dynamic changes during the catalytic cycle.

Native Mass Spectrometry:
Advances in maintaining intact membrane protein complexes during mass spectrometry analysis allow determination of subunit stoichiometry and interactions. This would be valuable for understanding how all six NQR subunits assemble.

Serial Crystallography: X-ray free-electron lasers (XFELs) enable structure determination from microcrystals, potentially overcoming the crystallization bottleneck for membrane proteins like Na(+)-NQR.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.