Recombinant Haemophilus somnus Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant nqrE is commercially available for:

  • Enzyme activity assays: Studying Na(+)-NQR kinetics and ion transport mechanisms .

  • Antigen production: Investigating immune responses to H. somnus surface proteins .

  • Structural biology: Analyzing membrane protein dynamics via X-ray crystallography or cryo-EM .

Comparative Genomics of nqrE

The nqrE gene (HS_1689) in H. somnus 129Pt shares metabolic pathway similarities with H. influenzae and H. ducreyi, but exhibits unique adaptations:

OrganismnqrE PresenceAssociated Pathways
H. somnus 129PtYes Sodium transport, ubiquinone biosynthesis
H. influenzae RdNo Lacks Na(+)-NQR; uses proton-pumping NADH dehydrogenase
H. ducreyi 35000HPNo Relies on menaquinone-based electron transport

Technical Notes for Experimental Use

  • Stability: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

  • Activity validation: Requires reconstitution with other Na(+)-NQR subunits (A–D, F) for full enzymatic function .

  • Commercial sources: Available from MyBioSource, Creative BioMart, and e-scapebio in quantities from 50 µg to bulk .

Implications for Pathogenicity Studies

While nqrE itself is not a virulence factor, its role in energy metabolism may influence H. somnus’s adaptability in host environments. Pathogenic strains often lack commensal strain genes like nqrE, suggesting metabolic trade-offs between colonization and invasion .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please indicate your desired format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference for your convenience.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type preference, please communicate it to us. We will prioritize the development of your specified tag.
Synonyms
nqrE; HS_1689; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Haemophilus somnus (strain 129Pt) (Histophilus somni)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGISVPVNQLVY SLILKDGALIDGVDLSFLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGIGAGTGWMLAIVALAGITEKMKYADVPAGLRGLGITF ITVGLMALGFMSFSGVQL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links

KEGG: hso:HS_1689

STRING: 205914.HS_1689

Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus and its clinical significance?

Haemophilus somnus (now also referred to as Histophilus somni) is a gram-negative bacterial pathogen that functions as the etiologic agent for multiple bovine diseases including pneumonia, septicemia, abortion, thrombotic meningoencephalitis, arthritis, and myocarditis. The organism's ability to cause such diverse pathologies makes it a significant concern in veterinary medicine and agricultural settings. The pathogenic versatility of H. somnus is attributed to several virulence factors including adherence mechanisms, immunoglobulin-binding proteins, enhanced survival within phagocytic cells, serum resistance properties, and notably, its lipooligosaccharide (LOS) structures . Understanding these factors provides essential context for research involving any H. somnus proteins, including the Na(+)-translocating NADH-quinone reductase subunit E.

What is the biochemical function of Na(+)-translocating NADH-quinone reductase subunit E?

Na(+)-translocating NADH-quinone reductase (NQR) functions as a respiratory complex that couples the oxidation of NADH to the establishment of a sodium gradient across the bacterial membrane. Specifically, the E subunit (nqrE) plays a crucial role in the electron transport chain of certain bacteria, functioning as one component of the multisubunit complex that catalyzes electron transfer from NADH to ubiquinone while simultaneously pumping sodium ions across the membrane. This mechanism is particularly important in marine and pathogenic bacteria that utilize sodium motive force rather than or in addition to proton motive force for energy conservation. In the context of H. somnus, this protein likely contributes to energy metabolism under the varying conditions encountered during infection processes, potentially influencing bacterial survival and pathogenicity through maintenance of membrane potential and energy production.

How does nqrE relate to the antigenic variation observed in H. somnus?

While nqrE itself is not directly implicated in antigenic variation based on the provided research data, H. somnus demonstrates significant antigenic and structural phase variation in its lipooligosaccharide (LOS) . This variation involves genes such as lob-1 and lob-2A, with the latter containing variable 5'-GA-3' repeats that affect protein expression and function. Understanding the relationship between metabolic proteins like nqrE and virulence-associated structures is important because energy production systems often indirectly influence virulence factor expression. The metabolic state of the bacterium, which is partially determined by proteins like nqrE, can influence gene expression patterns, including those involved in antigenic variation. Further research would be necessary to establish direct connections between nqrE function and LOS phase variation.

What expression systems are most effective for producing functional recombinant H. somnus nqrE?

Based on current research methodologies, the preferred expression system for producing functional recombinant H. somnus nqrE would typically involve:

  • E. coli Expression Systems: BL21(DE3) or similar strains containing T7 RNA polymerase under control of the lacUV5 promoter are commonly employed for membrane protein expression.

  • Vector Selection: Vectors containing histidine or other affinity tags facilitate purification while maintaining protein function. The tag placement (N-terminal vs. C-terminal) should be optimized through parallel constructs to determine which least affects function.

  • Induction Conditions: IPTG concentration (typically 0.1-0.5 mM), induction temperature (often lowered to 16-25°C for membrane proteins), and duration require optimization to balance yield with proper folding.

  • Membrane Fraction Isolation: Careful isolation of membrane fractions followed by detergent solubilization is critical for maintaining the native conformation of membrane-associated proteins like nqrE.

The key methodological consideration is maintaining the protein in conditions that preserve its structural integrity and functional properties, as membrane proteins often require specific lipid environments or detergents to maintain their native conformation.

How can researchers optimize mutagenesis protocols for studying nqrE function?

When designing mutagenesis experiments to study nqrE function, researchers should consider these methodological approaches:

  • Targeted Mutagenesis Strategy: Based on conservation analysis and structural predictions, select residues likely involved in sodium binding, quinone interaction, or subunit interfaces.

  • Suicide Vector Construction: Following the approach described for lob-2A in the literature, construct a suicide vector containing the nqrE gene with targeted mutations . This involves:

    • Cloning the nqrE gene into a vector that cannot replicate in H. somnus

    • Creating the desired mutation(s) via site-directed mutagenesis

    • Including an antibiotic resistance marker (such as kanamycin resistance) for selection

  • Electroporation and Selection: Transform H. somnus with the suicide vector and select for recombinants using appropriate antibiotics. PCR screening can then identify colonies with the desired genetic changes.

  • Phenotypic Validation: Test mutants for:

    • Growth rates under various sodium concentrations

    • Membrane potential measurements

    • NADH oxidation activity

    • Quinone reduction kinetics

    • Virulence in appropriate model systems

For more complex genetic manipulations, the PCR primers should be carefully designed to ensure specific amplification of the target region, as demonstrated in the approach used for analyzing lob-2A .

What are the critical factors for maintaining protein stability during purification of recombinant nqrE?

Maintaining stability of recombinant nqrE during purification requires careful consideration of several factors:

Purification PhaseCritical FactorsRecommended Approach
Cell LysisMembrane protein denaturationGentle lysis methods (osmotic shock, enzymatic methods) rather than sonication
SolubilizationDetergent selectionTest multiple detergents (DDM, LMNG, CHAPS) at minimal effective concentrations
Buffer CompositionpH stability rangeTypically Tris-based buffers at pH 7.5-8.0 with stabilizing agents
Storage ConditionsPreventing aggregation50% glycerol supplementation as used for commercial preparations
TemperatureThermal stabilityMaintain at -20°C for short-term or -80°C for extended storage
Freeze-ThawStructural integrityAvoid repeated freeze-thaw cycles; create single-use aliquots

The purification protocol should be validated by activity assays at each step to ensure the protein maintains its functional properties. As indicated in the commercial product information, glycerol supplementation at 50% appears to be effective for stabilizing this protein during storage .

How can researchers effectively analyze the role of nqrE in H. somnus virulence?

To analyze the potential role of nqrE in H. somnus virulence, researchers should employ a multifaceted approach similar to that used for studying lob-2A :

  • Gene Disruption Analysis: Create an nqrE knockout mutant through allelic exchange using a kanamycin resistance cassette, following the methodology described for lob-2A mutants . This involves:

    • Construction of a suicide vector containing disrupted nqrE

    • Electroporation into H. somnus

    • Selection and confirmation of mutants by PCR and Southern blotting

  • Serum Sensitivity Testing: Compare the sensitivity of wild-type and nqrE mutants to normal bovine serum through standardized bactericidal assays, as serum resistance is an important virulence determinant .

  • In Vivo Virulence Models: Assess virulence in mouse models by:

    • Comparing survival rates following challenge with wild-type versus mutant strains

    • Determining bacterial loads in various tissues

    • Analyzing histopathological changes

  • Complementation Studies: Restore nqrE function using shuttle vectors like pLS88 to confirm that observed phenotypes are specifically due to nqrE disruption.

  • Transcriptomic Analysis: Compare gene expression profiles between wild-type and nqrE mutants to identify downstream effects on virulence gene expression.

This integrated approach allows for both direct assessment of virulence and mechanistic understanding of how nqrE might influence pathogenicity.

What techniques can accurately measure nqrE activity in membrane preparations?

Accurate measurement of nqrE activity within the context of the complete Na(+)-translocating NADH-quinone reductase complex requires specialized techniques:

These methodologies collectively provide a comprehensive assessment of nqrE functionality within the larger NQR complex context.

How do researchers analyze Na(+) translocation mechanisms related to nqrE function?

Analysis of Na(+) translocation mechanisms related to nqrE function requires sophisticated biophysical and biochemical approaches:

  • Site-Directed Mutagenesis of Putative Na(+) Binding Sites:

    • Identify conserved residues potentially involved in Na(+) binding through sequence alignment with other NQR E subunits

    • Create point mutations of these residues

    • Assess the impact on Na(+) translocation and enzymatic activity

  • Ion Selectivity Analysis:

    • Compare enzyme activity and ion transport in buffers containing Na+, Li+, or K+

    • Determine apparent Km values for each ion

    • Establish selectivity profiles that inform translocation mechanism

  • Membrane Potential Measurements:

    • Use voltage-sensitive dyes (e.g., DiSC3(5))

    • Monitor membrane potential changes upon substrate addition

    • Quantify the relationship between NADH oxidation and membrane potential generation

  • Structural Studies:

    • Employ techniques like cryo-electron microscopy to analyze the structure of the entire NQR complex

    • Use computational modeling to predict ion channels through the complex

    • Validate structural predictions through cross-linking experiments and mass spectrometry

  • Electrophysiological Approaches:

    • Reconstitute purified NQR complex or nqrE into lipid bilayers

    • Measure ion currents using patch-clamp techniques

    • Characterize the ion transport properties under various conditions

How should researchers interpret conflicting data on nqrE function across different experimental systems?

When encountering conflicting data on nqrE function across different experimental systems, researchers should systematically evaluate:

  • Expression System Differences:

    • Compare protein folding efficiency in different hosts

    • Assess post-translational modifications that may differ between systems

    • Examine membrane composition variations that could affect function

  • Assay Condition Variations:

    • Standardize buffer compositions, particularly Na+ concentrations

    • Control temperature precisely across experimental systems

    • Ensure identical substrate concentrations and purity

  • Statistical Analysis Approach:

    • Apply appropriate statistical tests for each data type

    • Consider power analysis to ensure sufficient replication

    • Use meta-analysis techniques when comparing across multiple studies

  • Integrated Data Interpretation Framework:

    • Develop a model that accounts for contextual differences

    • Weight evidence based on methodological rigor

    • Identify conditions under which conflicts arise to inform mechanism

  • Validation Experiments:

    • Design experiments specifically to test alternative hypotheses

    • Use orthogonal methods to confirm key findings

    • Collaborate with groups using different systems to standardize approaches

What are the common pitfalls in analyzing the interaction between nqrE and other subunits of the NQR complex?

Analysis of interactions between nqrE and other NQR subunits presents several common challenges:

  • Detergent-Induced Artifacts:

    • Pitfall: Detergents necessary for membrane protein solubilization may disrupt native interactions

    • Solution: Compare multiple detergents; validate with native membrane analyses; use nanodisc reconstitution to provide more native-like environment

  • Transient Interaction Detection:

    • Pitfall: Weak or transient interactions may be missed in traditional pull-down assays

    • Solution: Employ cross-linking strategies; use surface plasmon resonance for real-time interaction kinetics; consider hydrogen-deuterium exchange mass spectrometry

  • Assembly Intermediates Misinterpretation:

    • Pitfall: Partially assembled complexes may be mistaken for functional subassemblies

    • Solution: Use size exclusion chromatography; conduct pulse-chase experiments; perform activity measurements of size-separated fractions

  • Overexpression Artifacts:

    • Pitfall: Non-physiological protein levels may force non-native interactions

    • Solution: Compare interaction patterns at different expression levels; validate with endogenous protein levels when possible

  • Incomplete Complex Reconstitution:

    • Pitfall: Missing cofactors or accessory proteins may prevent proper assembly

    • Solution: Analyze cofactor requirements systematically; consider heterologous expression of entire operons rather than individual subunits

By anticipating these challenges, researchers can design more robust experimental approaches for accurately characterizing nqrE interactions within the complete NQR complex.

How do researchers properly normalize and compare nqrE expression levels across different experimental conditions?

Proper normalization and comparison of nqrE expression levels requires rigorous methodology:

TechniqueNormalization ApproachAdvantagesLimitations
qRT-PCRReference genes (16S rRNA, gyrB)High sensitivity; quantitativeRNA quality critical; post-transcriptional regulation missed
Western BlotLoading controls (total protein)Protein-level data; can use epitope tagsSemi-quantitative; antibody specificity
ProteomicsInternal standards; consistent peptidesComprehensive; no antibody neededComplex data analysis; expensive
Reporter FusionsConstitutive control promotersIn vivo monitoring; temporal dataFusion may affect function

For optimal results, researchers should:

  • Validate Reference Standards:

    • For qRT-PCR, test multiple reference genes for stability under experimental conditions

    • For Western blots, verify linearity of signal across expected concentration range

  • Control for Technical Variables:

    • Standardize sample harvesting timing and conditions

    • Process all compared samples simultaneously when possible

    • Include inter-run calibrators for multi-batch experiments

  • Apply Appropriate Statistical Analysis:

    • Use methods that account for non-normal distributions common in expression data

    • Apply multiple testing corrections for large-scale comparisons

    • Report variance measures alongside means

  • Integrate Multiple Methods:

    • Confirm key findings with orthogonal techniques

    • Correlate transcript and protein levels to identify post-transcriptional regulation

    • Consider functional assays alongside expression measurements

This comprehensive approach ensures that observed differences in nqrE expression reflect genuine biological variation rather than technical artifacts.

What are the potential applications of nqrE in understanding bacterial energy metabolism beyond H. somnus?

The research on H. somnus nqrE has broader implications for understanding bacterial energy metabolism:

  • Comparative Analysis Across Bacterial Pathogens:

    • NQR complexes exist in various pathogens including Vibrio cholerae, Yersinia pestis, and Pseudomonas aeruginosa

    • Structural and functional comparison of nqrE across these species can reveal evolutionary adaptations in energy metabolism

    • Such analyses may identify conserved features essential for function versus species-specific adaptations

  • Metabolic Adaptation to Environmental Niches:

    • Research into how nqrE contributes to H. somnus survival in different host microenvironments provides insights into bacterial adaptation

    • The Na+ versus H+ bioenergetics preference may reflect adaptation to specific ionic conditions encountered during infection

    • Understanding these adaptations informs broader questions of bacterial evolution and host-pathogen interactions

  • Novel Antimicrobial Target Exploration:

    • Sodium-translocating respiratory complexes represent potential targets for species-selective antimicrobials

    • Structure-function studies of nqrE can guide rational drug design efforts

    • Inhibition of primary energy metabolism presents a strategy less prone to resistance development

  • Synthetic Biology Applications:

    • Engineered Na+-dependent bioenergetics systems could enable bacterial growth in high-salt environments

    • Modified nqrE components might be incorporated into synthetic electron transport chains with novel properties

    • Such applications have potential in bioremediation and industrial biotechnology

These broader applications demonstrate how fundamental research on H. somnus nqrE contributes to our understanding of bacterial bioenergetics across species and environments.

How might structural biology approaches enhance our understanding of nqrE function?

Advanced structural biology approaches offer significant potential for elucidating nqrE function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of the entire NQR complex without crystallization

    • Can capture different conformational states during the catalytic cycle

    • Provides insights into subunit interactions and the architecture of ion translocation pathways

    • Resolution has improved to near-atomic levels, allowing visualization of bound cofactors and substrates

  • Integrative Structural Biology:

    • Combines multiple techniques (X-ray crystallography, NMR, cross-linking mass spectrometry)

    • Creates comprehensive structural models when single techniques are insufficient

    • Particularly valuable for membrane protein complexes like NQR

  • Molecular Dynamics Simulations:

    • Models protein behavior in a lipid bilayer environment

    • Simulates ion movement through predicted channels

    • Tests hypotheses about conformational changes during the catalytic cycle

    • Increasingly accurate with improved force fields and computational resources

  • Time-Resolved Structural Studies:

    • Captures transient intermediates during the electron transfer process

    • Reveals dynamic aspects of protein function not visible in static structures

    • Emerging techniques like time-resolved cryo-EM and X-ray free electron lasers enable such studies

  • Structure-Guided Functional Studies:

    • Rational design of mutations based on structural information

    • Targeted chemical modification of specific residues

    • Structure-based computational prediction of substrate binding and catalytic mechanisms

These approaches collectively would provide unprecedented insights into how nqrE contributes to Na+ translocation coupled to electron transfer within the NQR complex.

What is the relationship between nqrE function and bacterial adaptation to host immune responses?

The relationship between nqrE function and bacterial adaptation to host immune responses represents an emerging research area:

  • Metabolic Flexibility During Infection:

    • Host immune responses often create resource-limited environments

    • NQR-based energy metabolism may provide advantages under specific host conditions

    • Understanding how nqrE contributes to metabolic adaptation could reveal survival strategies

  • Response to Oxidative Stress:

    • Phagocytes generate reactive oxygen species to kill bacteria

    • The redox activity of NQR complexes might influence cellular responses to oxidative stress

    • Research could examine how nqrE function affects susceptibility to oxidative killing

  • Membrane Potential and Antimicrobial Peptide Resistance:

    • Antimicrobial peptides often target bacterial membranes

    • Na+ gradient maintenance through nqrE activity may influence membrane properties

    • Studies could investigate correlations between NQR activity and antimicrobial peptide susceptibility

  • Energetic Requirements for Virulence Factor Expression:

    • Virulence factor production is energetically costly

    • NQR efficiency may determine the capacity for virulence factor synthesis

    • Research could explore how energy metabolism modifications affect virulence gene expression

  • Potential Interaction with Antigenic Variation Systems:

    • H. somnus exhibits LOS phase variation as an immune evasion strategy

    • The energetic state of the cell might influence phase variation rates

    • Studies examining nqrE mutants could reveal connections between energy metabolism and antigenic variation

This research direction would provide valuable insights into the intersection of bacterial bioenergetics and pathogenesis, potentially revealing new therapeutic approaches.

What are the critical knowledge gaps in our understanding of H. somnus nqrE?

Despite advances in understanding bacterial Na+-translocating NADH-quinone reductases, several critical knowledge gaps remain regarding H. somnus nqrE:

  • Structural Characterization: Unlike some other bacterial respiratory complexes, high-resolution structural data for H. somnus NQR components, including nqrE, remains limited. This gap hampers understanding of species-specific features and mechanism of action.

  • Regulation Mechanisms: The conditions that regulate nqrE expression during different stages of infection or environmental transitions are poorly characterized. Understanding these regulatory networks would provide insights into how H. somnus adapts its energy metabolism during pathogenesis.

  • Host-Specific Adaptations: How nqrE function in H. somnus differs from homologous proteins in other bacteria, particularly in relation to bovine host environments, remains largely unexplored. These adaptations may reveal important aspects of host-pathogen co-evolution.

  • Interaction with Virulence Systems: While H. somnus virulence factors like LOS have been studied , the relationship between energy metabolism proteins like nqrE and virulence factor expression requires further investigation. This connection could reveal how metabolic state influences pathogenicity.

  • In Vivo Relevance: The importance of Na+-based bioenergetics versus proton-based systems during actual infection processes remains unclear. In vivo studies tracking metabolic activity during infection would address this gap.

Addressing these knowledge gaps represents important directions for future research that would significantly enhance our understanding of H. somnus pathophysiology.

How might technological advances shape future research on bacterial Na(+)-translocating NADH-quinone reductase?

Emerging technologies will likely transform research on bacterial Na(+)-translocating NADH-quinone reductase in several ways:

  • Single-Cell Technologies:

    • Single-cell RNA sequencing can reveal heterogeneity in nqrE expression within bacterial populations

    • Microfluidic techniques allow real-time monitoring of individual bacterial responses to changing conditions

    • These approaches may uncover previously unrecognized subpopulation behaviors related to energy metabolism

  • Advanced Imaging Techniques:

    • Super-resolution microscopy can visualize protein localization within bacterial membranes

    • FRET-based sensors can monitor conformational changes during enzyme function

    • These techniques will provide spatial and temporal information about NQR complex dynamics

  • CRISPR-Based Technologies:

    • CRISPR interference allows precise, tunable gene repression rather than complete knockout

    • CRISPR-based screening can identify genetic interactions with nqrE

    • These approaches enable more nuanced manipulation of nqrE expression and function

  • Artificial Intelligence Applications:

    • Machine learning algorithms can identify patterns in complex datasets relating nqrE function to phenotypic outcomes

    • Computational prediction of protein-protein interactions can guide experimental design

    • These computational approaches accelerate discovery and generate novel hypotheses

  • Synthetic Biology Tools:

    • Designer membrane proteins with modified properties can test mechanistic hypotheses

    • Reconstitution of minimal respiratory systems in artificial membranes

    • These approaches enable precise control over system components for mechanistic studies

These technological advances will likely lead to unprecedented insights into the structure, function, and physiological significance of bacterial Na(+)-translocating NADH-quinone reductase complexes, including the role of nqrE.

What interdisciplinary approaches might yield new insights into nqrE biology?

The most promising advances in understanding nqrE biology will likely emerge from interdisciplinary approaches that integrate diverse scientific perspectives:

  • Evolutionary Biology and Bioenergetics:

    • Phylogenetic analysis of NQR complexes across bacterial species

    • Correlation of nqrE sequence variations with ecological niches

    • These approaches can reveal how different selective pressures have shaped nqrE function

  • Systems Biology and Infection Dynamics:

    • Network analysis of metabolic and virulence pathways

    • Mathematical modeling of energy flux during different infection stages

    • These approaches can contextualize nqrE function within broader cellular processes

  • Biophysics and Structural Biology:

    • Single-molecule studies of ion translocation events

    • Conformational dynamics during the catalytic cycle

    • These approaches provide mechanistic details at unprecedented resolution

  • Immunology and Bacterial Physiology:

    • Examination of how host immune responses affect bacterial energy metabolism

    • Investigation of metabolic adaptations to immune-mediated stress

    • These approaches connect nqrE function to host-pathogen interactions

  • Synthetic Chemistry and Enzymology:

    • Design of specific inhibitors targeting nqrE or the NQR complex

    • Creation of artificial electron acceptors to probe reaction mechanisms

    • These approaches provide tools for dissecting enzyme function and potential therapeutic development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.