Recombinant Haemophilus somnus Probable intracellular septation protein A (HSM_0792)

Shipped with Ice Packs
In Stock

Description

Basic Attributes

PropertyDetails
UniProt IDB0USN1 (strain 2336) / Q0I4W6 (strain 129Pt)
Gene NameHSM_0792 (strain 2336) / HS_1267 (strain 129Pt)
SpeciesHistophilus somni (strain 2336 or 129Pt)
Expression HostE. coli with N-terminal His tag
Protein LengthFull-length (1–179 amino acids)
Molecular Weight~20 kDa (calculated)
StorageTris/PBS buffer with 50% glycerol; stable at -20°C/-80°C

Amino Acid Sequence

The sequence begins with MKQLLEFIPLILFFAVYKLQGIQAAAITLIIATLIQLMILKLKYGKIEKQQLIMGSAVVFFGSLSAYFNELEFLKWKVTVVYALFSLILLVSQYGFKKPLIQQLLGKEIQLPTYVWHNLNLGWAVFFLLCMLINLYISQYLSDDIWVDFKTFGILGMTLIATLVTGVYIYRYLPKSEQE . The protein lacks a signal peptide, suggesting intracellular localization.

Role in Bacterial Physiology

  • Septation and Cell Division: As a putative intracellular septation protein, HSM_0792 is implicated in bacterial cell division, a critical process for replication and survival. Homologs in related pathogens (e.g., E. coli YciB) regulate membrane constriction during cytokinesis .

  • Intracellular Survival: H. somnus is a facultative intracellular pathogen capable of persisting in macrophages . HSM_0792 may contribute to evasion of host immune responses by modulating septation under stress conditions.

Virulence Associations

  • While not directly linked to immunoglobulin-binding proteins (e.g., p76 or HMW IgBPs) , HSM_0792’s role in cell division could indirectly support biofilm formation or resistance to phagocytosis, both key virulence traits in H. somnus .

  • Genomic analyses of H. somnus strains reveal conserved sequences for HSM_0792 across pathogenic and commensal isolates, suggesting functional indispensability .

Diagnostic and Therapeutic Development

  • Antigen Production: Recombinant HSM_0792 is used in ELISA kits to detect H. somnus-specific antibodies in cattle, aiding in surveillance of histophilosis outbreaks .

  • Vaccine Candidates: Surface-exposed septation proteins are potential targets for subunit vaccines. Preliminary studies on related proteins show partial protection in murine models .

Antimicrobial Targeting

  • Disrupting septation machinery (e.g., via small-molecule inhibitors) could combat H. somnus infections. Similar strategies are under investigation for other Gram-negative pathogens .

Comparative Genomic Insights

A genome-wide comparison of H. somnus strains (virulent vs. commensal) reveals:

FeatureStrain 2336 (Pathogenic)Strain 129Pt (Commensal)
Prophage Regions5 regions (GC content 31–40%) Similar prophage content
HSM_0792 ConservationFully conserved Fully conserved

Challenges and Future Directions

  • Functional Validation: Direct evidence of HSM_0792’s role in septation is lacking. Knockout studies or cryo-EM structural analyses are needed .

  • Antimicrobial Resistance: H. somnus exhibits rising resistance to β-lactams and macrolides . Targeting HSM_0792 could circumvent traditional resistance mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yciB; HSM_0792; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
HSM_0792
Target Protein Sequence
MKQLLEFIPLILFFAVYKLQGIQAAAITLIIATLIQLMILKLKYGKIEKQQLIMGSAVVF FGSLSAYFNELEFLKWKVTVVYALFSLILLVSQYGFKKPLIQQLLGKEIQLPTYVWHNLN LGWAVFFLLCMLINLYISQYLSDDIWVDFKTFGILGMTLIATLVTGVYIYRYLPKSEQE
Uniprot No.

Target Background

Function

This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity, and regulating membrane homeostasis.

Database Links

KEGG: hsm:HSM_0792

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the current taxonomic classification of Haemophilus somnus and how does it impact research on HSM_0792?

Haemophilus somnus has been reclassified as Histophilus somni, reflecting phylogenetic relationships established through molecular analysis. This reclassification is important when searching literature, as older publications use the former nomenclature while newer research uses the updated taxonomy . When conducting literature reviews on HSM_0792, researchers should search using both "Haemophilus somnus probable intracellular septation protein A" and "Histophilus somni probable intracellular septation protein A" to ensure comprehensive results. This taxonomic update reflects the organism's status as a Gram-negative pleomorphic coccobacillus that causes respiratory, reproductive, cardiac, and neuronal diseases in cattle .

What approaches are recommended for expressing and purifying recombinant HSM_0792?

For effective expression and purification of recombinant HSM_0792, researchers should consider the following methodology:

  • Vector Design: A mammalian expression vector like pcDNA3.1+ containing appropriate promoters (e.g., CMV) and selection markers (e.g., neomycin–kanamycin resistance gene) can be utilized for expression . Include detection tags (N-terminal HA-tag and C-terminal c-Myc) to facilitate protein identification and purification .

  • Expression System: Given that HSM_0792 is a bacterial membrane protein, expression in HEK-293T cells has been successful for similar recombinant bacterial proteins . The expected molecular weight of approximately 47 kDa should be confirmed during validation.

  • Purification Strategy: Since HSM_0792 is a membrane protein, solubilization with appropriate detergents followed by affinity chromatography targeting the incorporated tags is recommended. Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

  • Validation: Confirmation of protein identity and integrity through Western blot analysis using antibodies against the incorporated tags, followed by functional assays to verify biological activity .

How can researchers validate the structural integrity of recombinant HSM_0792?

Validation of recombinant HSM_0792 structural integrity requires multiple complementary approaches:

  • Molecular Modeling: Prior to protein production, in silico molecular modeling should be performed to predict protein structure and identify critical domains . This computational approach can guide subsequent experimental design and validation.

  • Circular Dichroism (CD): CD spectroscopy can determine secondary structure content (α-helices, β-sheets) and compare it to the predicted structure from bioinformatic analysis.

  • Western Blot Analysis: Confirm correct molecular weight and expression using antibodies against incorporated tags . Multiple antibodies targeting different epitopes can provide additional validation.

  • Mass Spectrometry: Peptide mass fingerprinting can verify the primary sequence and identify any post-translational modifications.

  • Functional Assays: Design assays based on predicted function in cell division to confirm biological activity, such as interaction with other divisome components using pull-down assays or microscopy-based localization studies .

How does HSM_0792 potentially contribute to H. somni pathogenesis in bovine infections?

The contribution of HSM_0792 to H. somni pathogenesis likely involves several mechanisms:

  • Intracellular Survival: H. somni is a facultative intracellular pathogen that can survive within bovine mononuclear phagocytes . Studies have demonstrated that H. somni multiplies within bovine monocytes (1-2 log₁₀ increase in 4 hours) while these same cells effectively kill E. coli . HSM_0792, as a septation protein, may facilitate bacterial division within these intracellular environments, contributing to persistent infection.

  • Evasion of Immune Killing: H. somni has developed mechanisms to evade killing by bovine neutrophils and macrophages . While neutrophils produce extracellular traps (NETs) in response to H. somni in a dose- and time-dependent manner , the bacterium can still survive. HSM_0792 may be involved in cell division processes that maintain bacterial viability despite immune pressure.

  • Membrane-Associated Functions: As a membrane protein, HSM_0792 may interact with host cell components or affect bacterial membrane properties that facilitate adhesion, invasion, or resistance to host defense mechanisms .

What experimental models are appropriate for studying HSM_0792's role in H. somni infection?

Several experimental models are suitable for investigating HSM_0792's role in H. somni infection:

  • In vitro Cellular Models:

    • Bovine neutrophil assays can assess NET formation and bacterial killing

    • Bovine mononuclear phagocyte models using colorimetric assays (e.g., MTT) to measure intracellular bacterial survival

    • Cultured bovine blood monocytes (BBM) to study bacterial persistence and replication

  • Gene Knockout/Mutation Studies:

    • Creation of HSM_0792 deletion or point mutation strains to assess impact on bacterial division, growth, and virulence

    • Complementation studies to confirm phenotypes are specifically due to HSM_0792 alterations

  • Bovine Infection Models:

    • Experimental infection in cattle to assess the role of HSM_0792 in colonization and disease progression

    • Vaccination studies using recombinant HSM_0792 to evaluate protective immunity

A comparative study of wild-type H. somni and HSM_0792 mutants should include the following measurements:

  • Growth kinetics in standard media

  • Survival within bovine phagocytes

  • NET induction capability

  • Resistance to antimicrobial peptides and oxidative stress

  • Virulence in animal models

How can researchers characterize the interaction between HSM_0792 and other divisome components?

Characterizing interactions between HSM_0792 and other divisome components requires multiple complementary approaches:

  • Bacterial Two-Hybrid Analysis: This system can identify potential protein-protein interactions between HSM_0792 and other cell division proteins (e.g., FtsZ, FtsA, FtsQ) . Positive interactions should be confirmed with secondary methods.

  • Co-immunoprecipitation: Using tagged versions of HSM_0792, researchers can pull down associated proteins from bacterial lysates and identify interacting partners through mass spectrometry .

  • Fluorescence Microscopy: Fluorescently tagged HSM_0792 can reveal its localization during different stages of cell division and co-localization with other divisome components . Time-lapse imaging can track dynamics of protein recruitment to the division site.

  • HADDOCK Molecular Docking: Computational approaches like HADDOCK (High Ambiguity Driven protein-protein DOCKing) can predict interactions between HSM_0792 and other divisome proteins . The method uses biological information to drive docking by introducing ambiguous interaction restraints (AIRs).

  • Atomic Force Microscopy (AFM): This technique can provide structural information about HSM_0792's interaction with other proteins or membranes at nanoscale resolution.

What is the role of HSM_0792 in bacterial cell division and how does it compare to septation proteins in other bacterial species?

HSM_0792's role in bacterial cell division likely parallels functions observed in other bacterial septation proteins while potentially having unique characteristics related to H. somni's pathogenic lifestyle:

  • General Septation Protein Functions: Based on homology to other bacterial systems, HSM_0792 likely participates in the assembly of the divisome complex that orchestrates cell division . In well-studied bacteria like E. coli, at least 15 proteins localize to the division site, forming the divisome ring across the cell width at midcell .

  • Comparative Analysis with E. coli: In E. coli, the division process involves sequential recruitment of proteins to form a multiprotein complex at the division site . FtsZ, a tubulin homolog, forms the Z-ring as the first element of the divisome, followed by recruitment of proteins like ZipA, FtsA, FtsEX, FtsQLB, and FtsW . HSM_0792 likely has a similar or equivalent function within this complex in H. somni.

  • Species-Specific Adaptations: Different bacterial species have evolved distinct mechanisms for division site recognition and regulation . For example, while E. coli uses the Min system and nucleoid occlusion to regulate Z-ring formation, other bacteria like Caulobacter crescentus use the MipZ protein to control Z-ring formation through bipolar gradients . HSM_0792 may represent a specialized adaptation of septation machinery in H. somni that facilitates division within host cells.

  • Potential Pathogenesis Link: The ability of H. somni to divide within bovine phagocytes despite host defense mechanisms suggests that HSM_0792 may have evolved specific features that enable division under stress conditions encountered during infection.

How might research on HSM_0792 contribute to developing new treatments for H. somni infections in cattle?

Research on HSM_0792 could enable several therapeutic approaches for H. somni infections in cattle:

  • Targeted Antimicrobial Development: As a septation protein essential for bacterial division, HSM_0792 represents a potential target for novel antimicrobials that specifically inhibit H. somni replication. High-throughput screening assays could identify small molecules that disrupt HSM_0792 function or its interactions with other divisome components.

  • Vaccine Development: The unique structural features of HSM_0792 could serve as the basis for subunit vaccine development . Studies have shown that vaccination with other H. somni components can reduce the risk of undifferentiated bovine respiratory disease (UBRD) . A combination approach incorporating HSM_0792 with existing vaccine components might provide enhanced protection.

  • Immunomodulatory Approaches: Understanding how H. somni evades killing by bovine immune cells could lead to immunomodulatory therapies that enhance bacterial clearance. For example, treatments that augment the antimicrobial activity of bovine neutrophils and macrophages could overcome H. somni's intracellular survival strategies .

  • Diagnostic Development: Research on HSM_0792 could yield improved diagnostic tools for detecting H. somni infections in cattle, enabling earlier intervention and better disease management.

What experimental approaches are recommended for assessing potential inhibitors of HSM_0792?

A comprehensive evaluation of potential HSM_0792 inhibitors should follow this methodological framework:

  • In Silico Screening and Design:

    • Computational modeling of HSM_0792 structure to identify potential binding sites

    • Virtual screening of compound libraries to identify candidate inhibitors

    • Molecular dynamics simulations to predict binding affinities and stability

  • Biochemical Assays:

    • Development of recombinant protein-based assays to assess direct binding of compounds to HSM_0792

    • Functional assays to measure inhibition of protein activity or interactions with other divisome components

  • Cellular Assays:

    • Growth inhibition assays using wild-type H. somni and HSM_0792 overexpression strains

    • Assessment of septum formation and cell division using microscopy techniques

    • Intracellular survival assays using bovine mononuclear phagocytes to evaluate compound efficacy against intracellular bacteria

  • Validation in Animal Models:

    • Evaluation of promising compounds in bovine infection models

    • Assessment of efficacy, pharmacokinetics, and safety in target species

  • Development of Resistance Assays:

    • Serial passage experiments to assess potential for resistance development

    • Whole genome sequencing to identify mechanisms of resistance

What approaches should be used to develop highly specific recombinant antibodies against HSM_0792?

Development of specific recombinant antibodies against HSM_0792 requires a systematic approach:

  • Antigen Design and Production:

    • Identify antigenic epitopes through computational prediction of surface-exposed regions of HSM_0792

    • Express and purify recombinant HSM_0792 or synthetic peptides corresponding to predicted epitopes

    • Ensure proper folding of recombinant protein to maintain conformational epitopes

  • Antibody Generation:

    • Utilize antibody engineering technologies to produce recombinant antibodies with high specificity and affinity

    • Consider phage display or yeast display technologies for antibody selection

    • Screen antibody libraries against both recombinant HSM_0792 and related bacterial proteins to identify highly specific binders

  • Validation and Characterization:

    • Assess antibody specificity through Western blot, ELISA, and immunoprecipitation assays

    • Confirm lack of cross-reactivity with related bacterial proteins

    • Determine affinity constants using surface plasmon resonance or biolayer interferometry

  • Application Development:

    • Optimize antibodies for different applications (Western blot, immunofluorescence, flow cytometry)

    • Develop standardized protocols for antibody use in research settings

    • Create positive and negative controls for each application

A significant advantage of recombinant antibodies is their renewability and lack of lot-to-lot variation, which addresses a common hindrance in research applications .

What are the key considerations for designing RNA interference experiments to study HSM_0792 function?

RNA interference (RNAi) approaches to study HSM_0792 function must address several technical challenges unique to bacterial systems:

  • Target Sequence Selection:

    • Identify regions of HSM_0792 mRNA that are accessible and unique compared to other bacterial genes

    • Design multiple siRNA/shRNA sequences targeting different regions of the transcript

    • Consider potential off-target effects through comprehensive bioinformatic analysis

  • Delivery System Development:

    • Bacterial cell walls present a barrier to traditional RNAi delivery methods

    • Consider antisense RNA approaches with promoter systems that function in H. somni

    • Evaluate bacteriophage-based delivery systems or conjugative plasmids

  • Validation Methods:

    • Quantify HSM_0792 mRNA levels using RT-qPCR to confirm knockdown

    • Assess protein reduction through Western blot or immunofluorescence

    • Characterize phenotypic changes in growth, division, and pathogenesis

  • Experimental Controls:

    • Include non-targeting control RNAs with similar nucleotide composition

    • Create rescue experiments with RNAi-resistant HSM_0792 variants

    • Consider CRISPR-based approaches as complementary or alternative strategies

  • Data Analysis Framework:

    • Develop clear criteria for determining significant effects on bacterial phenotypes

    • Integrate transcriptomic and proteomic analyses to identify compensatory mechanisms

    • Consider potential polar effects on downstream genes in the same operon

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.