Recombinant Haemophilus somnus Probable intracellular septation protein A (HS_1267)

Shipped with Ice Packs
In Stock

Description

Introduction to HS_1267 Protein

Haemophilus somnus Probable Intracellular Septation Protein A (HS_1267) is a membrane-associated protein identified in Haemophilus somnus (also known as Histophilus somni strain 129Pt). This protein belongs to the YciB family of inner membrane-spanning proteins and is characterized by its role in probable intracellular septation processes . The recombinant form of this protein typically contains a histidine (His) tag to facilitate purification and experimental applications, with the full-length protein consisting of 179 amino acids .

The protein is encoded by the HS_1267 gene in the H. somnus genome, with a UniProt identification number of Q0I4W6. Alternative names for this protein include yciB and Inner membrane-spanning protein YciB, reflecting its presumed location and function within the bacterial cell membrane system . As a recombinant protein, it is commonly expressed in Escherichia coli expression systems for research and commercial applications.

Physical Properties and Production Characteristics

The recombinant HS_1267 protein is typically produced with specific physical and chemical properties to enhance its stability and utility in research applications. Commercial preparations of the protein exhibit the following characteristics:

PropertySpecification
SourceExpressed in E. coli
Tag TypeN-terminal His tag
Protein LengthFull Length (1-179 amino acids)
Physical FormLyophilized powder
PurityGreater than 90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDQ0I4W6
Alternative NamesyciB, Inner membrane-spanning protein YciB

The high purity of greater than 90% as determined by SDS-PAGE analysis indicates the reliability of the recombinant protein for experimental applications . The protein's His-tag modification facilitates effective purification while preserving the protein's structural integrity and functional properties.

Role in Bacterial Cell Division

As its name suggests, the Probable Intracellular Septation Protein A likely plays a crucial role in bacterial cell division processes. Septation proteins typically participate in the formation of the septum, the structure that divides a bacterial cell during binary fission . While the specific molecular mechanisms of HS_1267 are not extensively documented in the available research, its classification as a septation protein suggests involvement in the complex process of bacterial cytokinesis.

Membrane-spanning proteins like HS_1267 often serve as anchoring points or scaffolds for the assembly of the division machinery, potentially interacting with other proteins involved in septum formation and cell wall synthesis. The protein's inner membrane localization positions it strategically to coordinate these processes between the cytoplasm and the periplasmic space in gram-negative bacteria like H. somnus.

Comparison with Other Bacterial Proteins

While the search results do not provide direct comparative data, it is worth noting that H. somnus possesses other significant proteins that have been better characterized. For instance, the high-molecular-weight (HMW) immunoglobulin binding proteins (IgBPs) and a 76-kDa surface protein (p76) have been identified in serum-resistant virulent strains but not in serum-sensitive strains from asymptomatic carriers . These proteins contribute to the virulence of H. somnus by enhancing its resistance to host immune responses.

Unlike these surface-exposed proteins that interact directly with host immune components, HS_1267 likely serves a more fundamental role in bacterial cell physiology as an intracellular protein. This distinction highlights the diverse functional repertoire of proteins produced by H. somnus, ranging from basic cellular processes to specialized virulence mechanisms.

Recombinant Expression Systems

The recombinant HS_1267 protein is predominantly produced using E. coli expression systems, which offer several advantages including high yield, cost-effectiveness, and relatively straightforward purification protocols . The inclusion of a His-tag, typically at the N-terminus of the protein, enables efficient purification using affinity chromatography techniques.

Commercial preparations typically involve expressing the full-length protein (amino acids 1-179) to maintain complete functional integrity. The purified protein is often provided in a lyophilized form to enhance stability during shipping and storage .

Research Applications

The recombinant HS_1267 protein has several potential applications in research settings:

  1. Structural studies: Investigating the three-dimensional structure of bacterial septation proteins

  2. Functional assays: Examining the role of HS_1267 in bacterial cell division

  3. Antibody production: Generating specific antibodies for immunodetection of native HS_1267

  4. Protein-protein interaction studies: Identifying binding partners involved in septation

  5. ELISA-based applications: Including diagnostic assays for detecting H. somnus infections

The availability of highly purified recombinant HS_1267 enables these research applications, contributing to our understanding of bacterial cell division mechanisms and potentially informing the development of novel antimicrobial strategies.

Context Within H. somnus Biology

Haemophilus somnus (now often referred to as Histophilus somni) is a gram-negative coccobacillus that causes a variety of diseases in cattle and sheep, including respiratory disease, thrombotic meningoencephalitis, myocarditis, arthritis, and reproductive disorders. Understanding the role of proteins like HS_1267 in the basic physiology of this bacterium may provide insights into its survival mechanisms and pathogenicity.

While the direct role of HS_1267 in virulence has not been established based on the available search results, intracellular septation proteins are fundamental to bacterial replication and survival. Disruption of essential cell division proteins could potentially impact bacterial growth and persistence in host environments.

Product Specs

Form
Lyophilized powder
Note: While we prefer to ship the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your requirements.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To ensure long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This concentration can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
yciB; HS_1267; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Haemophilus somnus (strain 129Pt) (Histophilus somni)
Target Names
HS_1267
Target Protein Sequence
MKQLLEFIPLILFFAVYKLQGIQAAAITLIIATLIQLMILKLKYGKIEKQQLIMGSAVVF FGSLSAYFNELEFLKWKVTVVYALFSLILLVSQYGFKKPLIQQLLGKEIQLPTYVWHNLN LGWAVFFLLCMLINLYISQYLSDDIWVDFKTFGILGMTLIATLVTGVYIYRYLPKSEQE
Uniprot No.

Target Background

Function
Plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: hso:HS_1267

STRING: 205914.HS_1267

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus HS_1267 and what is its predicted function?

HS_1267 is a protein encoded in the Haemophilus somnus genome annotated as a probable intracellular septation protein A. Based on sequence homology with septation proteins in other bacteria, it likely plays a critical role in cell division processes. Histophilus somni (formerly Haemophilus somnus) is a Gram-negative bacterium associated with multisystemic diseases of bovines . Septation proteins typically coordinate bacterial cell division by regulating the formation of the septum, which divides the parent cell into two daughter cells. By analogy with characterized septation proteins in other systems, HS_1267 may be involved in the septation initiation network (SIN) that couples cell division with cytokinesis, similar to SIN components observed in model organisms like Schizosaccharomyces pombe and Aspergillus nidulans .

How does HS_1267 relate to virulence in Haemophilus somnus infections?

While direct evidence linking HS_1267 to virulence is limited, proper cell division is essential for bacterial population growth and adaptation during infection. Haemophilus somnus possesses several virulence factors including lipo-oligosaccharide phase variation, mechanisms to induce apoptosis in host cells, strategies for intraphagocytic survival, and immunoglobulin Fc binding proteins . If HS_1267 is essential for normal cell division, disruption of this protein could potentially attenuate bacterial growth and subsequently impact virulence. Genome sequencing of virulent and avirulent H. somnus strains has facilitated identification of genes responsible for distinctive attributes within this species, which may include septation proteins like HS_1267 .

What experimental models are appropriate for studying HS_1267 function?

For in vitro studies, recombinant expression of HS_1267 in E. coli systems allows basic characterization of protein properties. For functional studies, both loss-of-function and gain-of-function approaches are valuable. Gene knockout or knockdown studies in H. somnus can reveal phenotypic changes related to cell division, while complementation experiments can confirm gene function. In vivo bovine models of H. somnus infection would be appropriate for studying the role of HS_1267 in pathogenesis, though ethical considerations and cost may limit such studies. Alternative models might include cell culture systems using bovine cell lines to study host-pathogen interactions.

What are the optimal conditions for recombinant expression of HS_1267?

The expression of recombinant HS_1267 typically requires careful optimization of multiple parameters:

ParameterRecommended ConditionsNotes
Expression SystemE. coli BL21(DE3) or RosettaRosetta strain recommended for rare codon usage
VectorpET28a(+) or pET-SUMON-terminal His-tag or SUMO-tag improves solubility
Induction0.1-0.5 mM IPTGLower concentrations may improve solubility
Temperature16-18°CReduced temperature often enhances proper folding
Duration16-20 hoursOvernight expression at lower temperature
MediaLB or 2×YT with supplementsAddition of 1% glucose may reduce basal expression

Pre-induction growth should be maintained at 37°C until OD600 reaches 0.6-0.8, followed by temperature reduction before induction. Testing multiple conditions in small-scale cultures is recommended before scaling up. If protein solubility remains an issue, consider expressing specific domains rather than the full-length protein.

What purification strategy yields the highest purity and activity of HS_1267?

A multi-step purification approach is recommended for obtaining high-purity, active HS_1267:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Tag removal: If applicable, cleave affinity tag using appropriate protease (thrombin for His-tag or SUMO protease for SUMO-tag)

  • Secondary purification: Ion exchange chromatography (IEX) using a resource Q column at pH 8.0

  • Polishing step: Size exclusion chromatography (SEC) using Superdex 200

  • Quality control: SDS-PAGE, Western blotting, and activity assays to confirm purity and functionality

Buffer optimization is crucial for protein stability. Consider including glycerol (10%), reducing agents like DTT or β-mercaptoethanol, and protease inhibitors. For long-term storage, flash-freeze aliquots in liquid nitrogen and store at -80°C after determining optimal buffer conditions through thermal shift assays.

How can I assess the functional activity of purified recombinant HS_1267?

Since HS_1267 is predicted to be involved in bacterial cell division, functional assays should focus on relevant biochemical activities:

  • GTPase activity assay: If HS_1267 belongs to the GTPase family like other septation proteins, measure GTP hydrolysis rates using colorimetric phosphate detection or HPLC-based methods.

  • Protein-protein interaction studies: Identify binding partners using pull-down assays, co-immunoprecipitation, or yeast two-hybrid screening. Priority targets would include other components of the septation machinery.

  • Microscopy-based cell division assays: Express fluorescently tagged HS_1267 in H. somnus or surrogate bacteria and monitor localization during cell division using time-lapse microscopy.

  • Complementation studies: Express HS_1267 in bacteria with mutations in homologous septation genes to test functional conservation.

  • In vitro reconstitution: Attempt to reconstitute elements of the septation process using purified components including HS_1267.

What computational methods can predict the structure-function relationship of HS_1267?

Multiple computational approaches can provide insights into HS_1267 structure and function:

  • Homology modeling: Generate 3D structural models using templates from related proteins, particularly those involved in septation in other bacterial species. Tools like SWISS-MODEL, Phyre2, or AlphaFold2 are recommended.

  • Domain prediction: Identify functional domains using tools like SMART, Pfam, InterPro, and CDD to recognize conserved regions with known functions.

  • Molecular dynamics simulations: Examine protein stability, flexibility, and potential binding interfaces using GROMACS, AMBER, or NAMD software packages.

  • Protein-protein docking: Predict interactions with other septation proteins using tools like HADDOCK, ClusPro, or AutoDock.

  • Evolutionary analysis: Perform multiple sequence alignments with homologs and analyze conservation patterns to identify functionally important residues.

  • Machine learning approaches: Apply newer ML-based methods to predict protein function based on sequence patterns and structural features.

The results from these analyses should guide experimental design by identifying critical residues for mutagenesis studies and potential binding interfaces for interaction studies.

What experimental approaches can determine the 3D structure of HS_1267?

Several experimental techniques can be employed to resolve the structure of HS_1267, each with distinct advantages:

TechniqueResolutionSample RequirementsAdvantagesLimitations
X-ray CrystallographyHigh (1-3Å)Protein crystalsAtomic-level detailRequires crystallization
Cryo-EMMedium-High (2-4Å)Purified proteinNo crystallization neededSize limitations
NMR SpectroscopyMedium (solution)Isotope-labeled proteinDynamic informationSize limitations
Small-angle X-ray Scattering (SAXS)Low (envelope)Solution sampleNative conditionsLow resolution

For X-ray crystallography, screening multiple crystallization conditions is essential. For cryo-EM, consider forming complexes with binding partners to increase size if HS_1267 is too small for effective imaging. For NMR, 15N and 13C labeling will be necessary for full structure determination. Multiple complementary approaches often provide the most comprehensive structural insights.

How can site-directed mutagenesis help characterize the functional domains of HS_1267?

Site-directed mutagenesis is a powerful approach to identify critical residues for HS_1267 function:

  • Target selection: Choose residues for mutation based on:

    • Conserved amino acids identified through sequence alignment

    • Predicted active site or binding interface residues

    • Residues in predicted functional domains

    • Charged or hydrophobic patches on the protein surface

  • Mutation types:

    • Conservative substitutions to test specific chemical properties

    • Alanine scanning to neutralize side chain effects

    • Introduction of specific properties (e.g., phosphomimetic mutations)

  • Functional assessment:

    • Express mutant proteins and assess biochemical activities

    • Test ability to complement knockout strains

    • Evaluate changes in protein-protein interactions

    • Examine subcellular localization

  • Interpretation:

    • Correlate mutations with functional changes to map critical regions

    • Generate a functional map of the protein

    • Identify potentially druggable sites

Particular attention should be paid to residues that might participate in GTP binding or hydrolysis if HS_1267 functions similarly to other septation proteins involved in GTPase activity .

How does HS_1267 expression change during different stages of infection?

Understanding expression patterns of HS_1267 during infection requires both in vitro and in vivo approaches:

  • In vitro condition mimicking:

    • Measure expression under conditions that mimic host environments (temperature, pH, oxygen limitation, nutrient restriction)

    • Compare expression in biofilm vs. planktonic growth

    • Examine expression changes in response to host immune factors

  • Host cell co-culture models:

    • Monitor expression during adhesion to and invasion of bovine cells

    • Assess expression changes during intracellular survival phases

  • In vivo sampling:

    • Isolate bacteria from different sites of infection in animal models

    • Use RNA-Seq or qRT-PCR to quantify gene expression

    • Consider laser capture microdissection of infected tissues

  • Reporter systems:

    • Develop fluorescent or luminescent reporter strains to track expression in real-time

    • Use dual-reporter systems to compare HS_1267 expression with known virulence factors

Data from these studies can be analyzed using time-series approaches to map expression changes to specific stages of infection, providing insights into when HS_1267 may be most critical for bacterial survival and pathogenesis.

Can HS_1267 be targeted to develop novel antimicrobial strategies against H. somnus?

Septation proteins represent potential antibiotic targets due to their essential role in bacterial cell division. For HS_1267 specifically:

  • Target validation:

    • Confirm essentiality through conditional knockout studies

    • Demonstrate growth inhibition when protein function is compromised

    • Show specificity by comparing with host homologs (if any)

  • High-throughput screening approaches:

    • Develop biochemical assays suitable for screening (e.g., GTPase activity)

    • Design cell-based assays to identify compounds that affect septation

    • Perform virtual screening against the predicted binding pocket

  • Structure-based drug design:

    • Use structural information to design inhibitors of activity or protein-protein interactions

    • Focus on unique structural features compared to other bacterial species

  • Potential advantages as a drug target:

    • Novel mechanism of action to address antimicrobial resistance

    • Potential specificity for certain bacterial groups

    • Essential function making resistance development more difficult

  • Delivery considerations:

    • Strategies to ensure compound penetration into Gram-negative bacteria

    • Formulation approaches for bovine respiratory and systemic infections

The development of septation inhibitors could provide new options for treating Histophilus somni infections, particularly in cases where conventional antibiotics face resistance issues .

How conserved is HS_1267 across different strains of H. somnus and related species?

Comparative genomic analysis provides insights into the evolutionary importance and functional conservation of HS_1267:

  • Within-species conservation:

    • Analyze sequence conservation across multiple H. somnus strains

    • Identify any strain-specific variations that might correlate with virulence differences

    • Determine if the gene is part of the core genome or accessory genome

  • Cross-species comparison:

    • Identify orthologs in related Pasteurellaceae family members

    • Extend comparison to more distant Gram-negative bacteria

    • Analyze synteny to determine if gene context is conserved

  • Domain conservation analysis:

    • Determine which protein domains show highest conservation

    • Identify variable regions that might confer species-specific functions

    • Compare predicted functional sites across species

  • Selection pressure analysis:

    • Calculate dN/dS ratios to detect regions under positive or purifying selection

    • Identify any evidence of horizontal gene transfer

    • Analyze codon usage patterns for evidence of selection

Genomic sequencing of multiple H. somnus strains has facilitated such comparative analyses, allowing for the identification of genes responsible for distinctive attributes within this species and related bacteria .

What functional homology exists between HS_1267 and septation proteins in model organisms?

Septation proteins are widely distributed across bacterial species, with functional conservation despite sequence divergence:

  • Functional homologs in model bacteria:

    • Compare with E. coli FtsZ and associated division proteins

    • Analyze similarities with B. subtilis septation machinery

    • Examine relationship to Caulobacter crescentus cell division proteins

  • Relationship to eukaryotic septation systems:

    • Compare with septation initiation network (SIN) components in S. pombe

    • Analyze similarities with mitotic exit network (MEN) in S. cerevisiae

    • Examine functional parallels with filamentous fungi like A. nidulans

  • Conserved protein interactions:

    • Identify if binding partners are also conserved across species

    • Determine if regulatory mechanisms are similar

    • Compare localization patterns during cell division

The SIN pathway in model organisms like S. pombe and A. nidulans uses the spindle pole body as a scaffold to initiate signaling, with key components including GTPases and protein kinases that form a conserved signaling cascade . Functional studies can reveal whether HS_1267 participates in analogous processes in H. somnus.

How can CRISPR-Cas9 technology be applied to study HS_1267 function in H. somnus?

CRISPR-Cas9 genome editing offers powerful approaches for investigating HS_1267:

  • Gene knockout strategies:

    • Design sgRNAs targeting HS_1267 with minimal off-target effects

    • Develop transformation protocols optimized for H. somnus

    • Use counterselection markers to identify successful editing events

    • Consider inducible CRISPR systems for essential genes

  • CRISPRi approaches for gene repression:

    • Use catalytically inactive Cas9 (dCas9) fused to repressors

    • Titrate repression levels to study partial loss of function

    • Design time-course experiments to determine effects at different growth phases

  • CRISPRa for overexpression studies:

    • Employ dCas9 fused to activators to increase expression

    • Assess effects of HS_1267 overexpression on cell division and virulence

  • Base editing applications:

    • Use CRISPR base editors to create specific point mutations

    • Target predicted functional residues without creating double-strand breaks

    • Generate series of mutations to map structure-function relationships

  • Tagging for localization and interaction studies:

    • Knock-in fluorescent proteins or affinity tags

    • Create fusion proteins to track localization during cell division

    • Facilitate purification of native protein complexes

For H. somnus, adaptation of CRISPR protocols may be necessary due to its specific genetic background, potential restriction systems, and transformation efficiency challenges.

What insights can proteomics approaches provide about HS_1267 interaction networks?

Advanced proteomics techniques can reveal the protein interaction landscape of HS_1267:

  • Immunoprecipitation-Mass Spectrometry (IP-MS):

    • Use antibodies against native HS_1267 or tags on recombinant protein

    • Identify co-precipitating proteins through LC-MS/MS

    • Compare interaction networks under different growth conditions

  • Proximity labeling approaches:

    • Fuse HS_1267 to BioID, TurboID, or APEX2 enzymes

    • Biotinylate proximal proteins in living bacteria

    • Purify and identify labeled proteins by mass spectrometry

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use chemical crosslinkers to capture transient interactions

    • Identify interaction interfaces at amino acid resolution

    • Generate restraints for structural modeling of complexes

  • Thermal Proteome Profiling (TPP):

    • Monitor thermal stability changes of proteins in response to HS_1267 deletion

    • Identify proteins whose stability depends on HS_1267 interaction

  • Quantitative interaction proteomics:

    • Use SILAC, TMT, or label-free quantification

    • Compare interaction dynamics across conditions

    • Identify core vs. condition-specific interactions

These approaches could reveal how HS_1267 functions within the broader septation network, similar to how MztA has been shown to interact with septation pathways in model fungi .

What advanced imaging techniques can visualize HS_1267 during bacterial cell division?

Cutting-edge microscopy methods can provide unprecedented insights into HS_1267 dynamics:

  • Super-resolution microscopy:

    • STORM/PALM for nanometer-scale localization of fluorescently tagged HS_1267

    • SIM for improved resolution of protein distribution during septation

    • STED microscopy for live-cell imaging below the diffraction limit

  • Single-molecule tracking:

    • Follow individual HS_1267 molecules during cell division

    • Determine diffusion rates and residence times at the septation site

    • Identify directed movement patterns suggesting active transport

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Visualize HS_1267 in relation to membrane and peptidoglycan structures

  • Expansion microscopy:

    • Physically expand bacterial cells for improved resolution

    • Particularly useful for small bacteria like H. somnus

  • Advanced fluorescence techniques:

    • FRET to monitor protein-protein interactions in real-time

    • FRAP to assess protein turnover at the division site

    • Fluorescence fluctuation spectroscopy to determine protein stoichiometry

  • Cryo-electron tomography:

    • Visualize native septation complexes at molecular resolution

    • Generate 3D reconstructions of division machinery in situ

These techniques could reveal the dynamic behavior of HS_1267 during the bacterial cell cycle, similar to how septation proteins in model organisms have been shown to transition between the spindle pole body and cell division site .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.