Recombinant Haemophilus somnus Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to Haemophilus somnus UbiB

Haemophilus somnus is a Gram-negative bacterium that causes a variety of diseases in cattle, including pneumonia, septicemia, and reproductive disorders . Virulent strains of H. somnus express high-molecular-weight immunoglobulin-binding proteins (IgBPs) . The UbiB protein, also known as Probable ubiquinone biosynthesis protein UbiB, plays a role in the ubiquinone biosynthesis pathway . Ubiquinone, or coenzyme Q (CoQ), is a vital component in the electron transport chain, which is essential for cellular respiration and ATP production .

Characteristics of Recombinant Haemophilus somnus UbiB Protein

Recombinant Haemophilus somnus UbiB is produced using genetic engineering techniques, where the gene encoding UbiB is inserted into a host organism (e.g., E. coli) to produce the protein in large quantities . The recombinant protein can then be isolated and purified for research and industrial applications . Recombinant Haemophilus somnus Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (Q0I208) (1-544aa), fused to N-terminal His tag, was expressed in E. coli .

Key features of the recombinant protein :

  • Source: E. coli

  • Tag: His-tagged

  • Protein Length: Full Length (1-544 amino acids)

  • Form: Lyophilized powder

  • Purity: Greater than 90% as determined by SDS-PAGE

  • Storage: Store at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles.

  • Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Function and Importance of UbiB in Ubiquinone Biosynthesis

UbiB is involved in the early steps of ubiquinone biosynthesis . UbiB family proteins regulate cellular CoQ distribution in Saccharomyces cerevisiae . It is essential for providing membranes throughout the cell with the CoQ necessary for enzymatic reactions and antioxidant defense .

UbiB as a Vaccine Target

Haemophilus somnus expresses surface fibrillar networks that have IgG2 binding activity . Given the limitations of existing vaccines against H. somnus infections, researchers have explored new vaccine candidates using a reverse vaccinology approach .

Immunoglobulin-Binding Properties of Haemophilus somnus

Haemophilus somnus immunoglobulin-binding proteins (IgBPs) are associated with virulence, but only one (p76) has been genetically defined . Two IgBP-positive serum-resistant virulent strains have a surface fibrillar network . Fibrils on the surfaces of IgBP+ strains bound gold-labelled bovine immunoglobulin G2 (IgG2) anti-DNP, indicating that these fibrils have IgG2 binding activity . A gene (immunoglobulin binding protein A, ibpA) encoding the HMW and p76 IgBPs comprised a single open reading frame of 12,285 base pairs (bp) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, please specify any format requirements in your order notes for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request; however, additional charges will apply. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; HS_0544; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Haemophilus somnus (strain 129Pt) (Histophilus somni)
Target Names
ubiB
Target Protein Sequence
MKLNDIKRLYKIVRVFLSYGIDEILPHNKYTRSIRCWRMLFFWLKNKHKNKAFGLCLRLA LQELGPVWIKLGQMLSTRRDLFPAEIADELALLQDNVEAFSGKIARQQIEQALGSSLENW FTDFDENALASASIAQVHTAKLKLGEEQEKEVVIKVLRPNIQPQIEADLSWMYKLAGLLP KLFREGYRLRAVEVIQEYEKTLRDELDLRVEMANAIKLRENFLDSPMLYIPKMYEAFCHK NVIVMERIYGIPVSDVETLQRNGTDMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVNP HYPENPQYIGIDCGIVGKLNESDKRYLAESFVAFFNRDYRRVAQMHVDAGWTPQDTNIDD FEQAFREVCEPIFAKPLSEISFAQVLLNLFNVAREFNMQVQPQLVLLQKTLLYIEGLGRQ LYPQLDLWDTAKPFLQNWLNEQIGMKVTFKKLKAKLPYLQEHLPDFPETLMDALKQQKFI SQQLVEINKKLAKQQRWQKKMFVLIVGIVIFSVTLWQFAALPLAISAGLFLVGFLVWLIG FLLP
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links

KEGG: hso:HS_0544

STRING: 205914.HS_0544

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What challenges arise in expressing and purifying recombinant H. somni UbiB protein, and how can they be addressed?

Expression and purification of recombinant H. somni UbiB presents several technical challenges:

a) Membrane association - UbiB likely has membrane-associating domains, complicating solubility during expression and purification. This can be addressed through:

  • Use of specialized detergents or amphipols to solubilize membrane proteins

  • Fusion with solubility-enhancing tags (MBP, SUMO, etc.)

  • Designing truncated constructs that exclude membrane-spanning regions

b) Protein folding and stability - Ensuring proper folding in heterologous expression systems requires:

  • Testing multiple expression hosts (E. coli BL21, C41/C43 strains designed for membrane proteins)

  • Optimizing expression temperature (often lower temperatures improve folding)

  • Co-expression with chaperones from H. somni

c) Genetic adaptation - H. somni's genomic plasticity due to horizontal gene transfer may lead to strain-specific variations in the ubiB gene. Researchers should:

  • Sequence the ubiB gene from their specific H. somni strain before designing expression constructs

  • Consider codon optimization for the expression host

  • Test multiple strain variants if initial attempts fail

d) Functional verification - After purification, confirming that recombinant UbiB retains function through:

  • Complementation of ubiB-deficient bacterial strains

  • In vitro activity assays (challenging due to UbiB's poorly understood biochemical mechanism)

  • Structural integrity assessment via circular dichroism or thermal shift assays

These methodological considerations are essential for researchers attempting to produce recombinant UbiB for structural studies, antibody production, or functional characterization.

  • How does horizontal gene transfer influence the evolution of the ubiB gene in H. somni and other Pasteurellaceae?

Horizontal gene transfer (HGT) significantly impacts H. somni genome evolution and likely influences ubiB:

a) Comparative genomic evidence shows that bacteriophage- and transposon-mediated HGT has created substantial genomic diversity between H. somni strains . Analysis of strains 2336 and 129Pt revealed that many genes common to both strains were located in different chromosomal regions and orientations, indicating extensive genome rearrangement .

b) For metabolic genes like ubiB, HGT may result in:

  • Acquisition of variant ubiB alleles with potentially altered function

  • Changes in gene regulation due to insertion in new genomic contexts

  • Co-transfer with other ubiquinone biosynthesis genes

c) Methodological approaches to study this phenomenon include:

  • Phylogenetic analysis of ubiB sequences across multiple H. somni isolates and related Pasteurellaceae

  • Identification of mobile genetic elements flanking the ubiB gene

  • Functional comparison of ubiB alleles from different strains

d) Understanding ubiB evolution through HGT could reveal how H. somni adapts its respiratory metabolism to different host environments, potentially contributing to its pathogenic versatility.

  • What is the potential relationship between UbiB function and antimicrobial resistance in H. somni?

While no direct evidence links UbiB to antimicrobial resistance in H. somni, several connections can be hypothesized and tested:

a) Metabolic state influence on antibiotic susceptibility:

  • Bacteria with altered respiratory chains often show different antibiotic susceptibility profiles

  • UbiB function affects ubiquinone production and thus respiratory efficiency

  • Experimental approach: Compare antibiotic minimum inhibitory concentrations (MICs) in wild-type versus ubiB-modulated H. somni strains

b) Energy-dependent resistance mechanisms:

  • Many resistance mechanisms (efflux pumps, enzymatic modifications) require energy

  • UbiB's role in respiration affects cellular energy production

  • Testing methodology: Measure expression and activity of resistance determinants in conditions where UbiB function is altered

c) Stress adaptation cross-protection:

  • H. somni isolates show variable resistance to multiple antibiotics, including β-lactams, aminoglycosides, and tetracyclines

  • Stress responses triggered by metabolic perturbation might upregulate resistance determinants

  • Experimental approach: Transcriptomic analysis of ubiB mutants to identify upregulated stress response and resistance genes

d) Horizontal gene transfer connections:

  • Antimicrobial resistance in H. somni is largely acquired through horizontal gene transfer

  • The same mobile genetic elements might affect both resistance genes and metabolic genes like ubiB

  • Research strategy: Analyze genomic contexts of ubiB and resistance determinants to identify potential co-transfer events

Understanding these relationships could inform strategies to combat antimicrobial resistance in H. somni, which is an increasing concern for bovine respiratory disease treatment .

  • How might targeting UbiB function contribute to novel vaccine strategies against H. somni infections?

Current H. somni vaccines primarily use killed whole bacteria and have variable efficacy , creating opportunity for novel approaches involving UbiB:

a) Metabolically attenuated vaccine strains:

  • Regulated expression of ubiB could create attenuated strains with reduced virulence but retained immunogenicity

  • Advantage: Such strains might present antigens in their native conformation while being unable to cause disease

  • Methodological approach: Create H. somni strains with inducible or temperature-sensitive ubiB expression for controlled attenuation

b) UbiB as a potential antigen component:

  • While UbiB itself may not be highly immunogenic as a membrane-associated metabolic protein, it could be combined with known protective antigens

  • Experimental evidence shows that recombinant subunits of IbpA (Immunoglobulin binding protein A) provide moderate protection against H. somni septicemia in mice

  • Research strategy: Evaluate UbiB-IbpA fusion proteins for enhanced protective immunity

c) Culture supernatant vaccine enhancement:

  • Studies demonstrate that culture supernatant containing IbpA shed from the bacterial surface provides better protection than formalin-killed bacteria

  • Methodology: Investigate whether manipulating UbiB function affects the composition or immunogenicity of these protective supernatant fractions

d) Adjuvant development through metabolic targeting:

  • Understanding UbiB's role in bacterial metabolism could inform development of adjuvants that enhance immune responses

  • Research approach: Test whether sub-inhibitory targeting of UbiB function increases antigen presentation or immune stimulation

These approaches offer multiple avenues to improve upon current H. somni vaccines, potentially addressing their variable efficacy and occasional adverse reactions in cattle .

  • What methodological approaches can be used to study the structure-function relationship of UbiB?

Understanding UbiB's structure-function relationship requires multidisciplinary approaches:

a) Structural determination methods:

  • X-ray crystallography of purified recombinant UbiB (challenging due to membrane association)

  • Cryo-electron microscopy for larger complexes containing UbiB

  • Nuclear magnetic resonance for structural analysis of specific domains

  • Computational modeling based on homology to better-characterized proteins like COQ8

b) Functional mapping through mutagenesis:

  • Alanine scanning mutagenesis to identify essential residues

  • Domain swapping between UbiB proteins from different species

  • Introduction of mutations based on natural variants identified in different H. somni strains

c) Protein-protein interaction analysis:

  • Bacterial two-hybrid screening to identify interaction partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Surface plasmon resonance to quantify binding affinities

  • Cross-linking mass spectrometry to map interaction interfaces

d) Enzymatic characterization:

  • Development of in vitro assays to measure UbiB's contribution to ubiquinone biosynthesis

  • Testing the effects of potential inhibitors like those developed for COQ8

  • Isotope labeling to track metabolic flux through the ubiquinone pathway

These approaches face technical challenges due to UbiB's likely membrane association and the difficulty of reconstituting multi-enzyme pathways in vitro, but together they can provide comprehensive insights into how UbiB structure relates to its function in ubiquinone biosynthesis.

  • How can the latest advances in inhibitor development for human COQ8 be applied to studying bacterial UbiB proteins?

Recent research has identified TTP-UNC-CA157 as a potent inhibitor of human COQ8 proteins involved in ubiquinone biosynthesis . This breakthrough provides opportunities for studying bacterial UbiB:

a) Structure-based inhibitor design:

  • Using the COQ8 inhibitor structure as a starting point for developing bacterial UbiB inhibitors

  • Methodology: Computational modeling and docking studies to identify key differences between human COQ8 and bacterial UbiB binding sites

  • Experimental validation through synthesis of modified inhibitors with selectivity for bacterial proteins

b) Probe development for mechanistic studies:

  • Chemical biology approaches using inhibitor derivatives as probes to study UbiB function

  • Research strategy: Create affinity-based probes that can capture UbiB protein complexes

  • Functional outcomes: Determine whether bacterial UbiB has similar enzymatic mechanisms to human COQ8

c) Comparative inhibition studies:

  • Testing COQ8 inhibitors against bacterial UbiB to map conservation of binding sites

  • Experimental design: Measure effects on ubiquinone biosynthesis in bacterial cultures exposed to inhibitors

  • Data interpretation: Differences in inhibition profiles between bacterial species may reveal functional variations

d) Therapeutic exploration:

  • Selective inhibition of bacterial UbiB without affecting human COQ8 could represent a novel antimicrobial strategy

  • Research approach: Screen for compounds that specifically inhibit H. somni UbiB

  • Potential application: Treatment options for bovine respiratory disease caused by H. somni, particularly in cases with antimicrobial resistance

These approaches leverage cutting-edge chemical biology techniques to advance understanding of bacterial UbiB function while potentially developing new research tools and therapeutic strategies.

  • What is the experimental evidence for UbiB's specific biochemical function in the ubiquinone biosynthesis pathway?

The precise biochemical function of UbiB remains incompletely characterized, but several lines of evidence provide insights:

a) Genetic evidence:

  • In E. coli, ubiB mutants accumulate octaprenylphenol and lack ubiquinone

  • The P. stuartii aarF gene (homologous to ubiB) when disrupted also leads to accumulation of octaprenylphenol

  • These findings position UbiB's function at the first monooxygenase step in the pathway

b) Structural classification:

  • UbiB belongs to the protein kinase-like family but its function differs from typical kinases

  • Human homologs (COQ8A/B) are considered "pseudo-kinases" that lack typical kinase activity but retain ATP binding

  • Experimental approach: ATP binding assays and structural studies to determine how UbiB interacts with nucleotides

c) Protein interactions:

  • UbiB likely functions as part of a complex with other ubiquinone biosynthesis enzymes

  • Methodology: Protein crosslinking and co-immunoprecipitation to identify interaction partners

  • Functional validation: Reconstitution of partial reaction sequence with purified components

d) Comparative biochemistry:

  • Testing whether bacterial UbiB can complement COQ8 deficiency in yeast or human cells

  • Experimental design: Express bacterial UbiB in COQ8-deficient systems and measure ubiquinone production

  • Interpretation: Functional complementation would suggest conserved biochemical roles despite sequence divergence

This evidence collectively suggests that UbiB enables the oxygen-dependent steps in ubiquinone biosynthesis, though the exact mechanism (direct catalysis vs. scaffolding function) remains to be fully elucidated.

  • How might UbiB function vary across different H. somni strains isolated from distinct clinical presentations?

H. somni causes diverse clinical manifestations including pneumonia, septicemia, and thrombotic meningoencephalitis . The relationship between UbiB function and these different disease presentations is unexplored but could be investigated through:

a) Comparative genomic analysis:

  • Sequencing ubiB genes from H. somni isolates associated with different clinical presentations

  • Methodology: Phylogenetic analysis to identify correlations between ubiB variants and disease types

  • Data presentation: Creation of sequence variation maps highlighting strain-specific differences

b) Functional characterization of strain variants:

  • Expression of ubiB alleles from different strains in a common genetic background

  • Experimental approach: Complementation of ubiB-deficient bacteria with strain-specific variants

  • Measurement outcomes: Growth rates, ubiquinone production levels, and stress resistance

c) Host adaptation considerations:

  • Different host environments (lung vs. bloodstream vs. brain) have varying oxygen tensions

  • Research question: Do H. somni strains from different sites have adaptations in UbiB function optimized for their niche?

  • Methodology: Measure UbiB activity under oxygen concentrations mimicking different host environments

d) Transcriptional regulation comparison:

  • Analysis of ubiB expression patterns in strains from different disease presentations

  • Experimental design: qRT-PCR and/or RNA-seq under conditions simulating different host environments

  • Interpretation: Differential regulation may indicate adaptation to specific pathogenic niches

This research would contribute to understanding how metabolic adaptations through UbiB might influence H. somni's ability to cause different disease manifestations in cattle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.