Recombinant Haemophilus somnus Protease HtpX (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Histophilus somni

HtpX homologs in related Pasteurellaceae species (e.g., E. coli, Haemophilus parasuis) exhibit stress-inducible proteolytic activity:

  • Membrane Protein Quality Control: Degrades misfolded membrane proteins (e.g., SecY) under stress conditions, preventing cytotoxicity .

  • Antibiotic Stress Response: Subinhibitory doses of tilmicosin upregulate htpX in H. parasuis, suggesting a role in countering antibiotic-induced proteotoxic stress .

  • Thermal Adaptation: Heat shock triggers htpX expression, implicating it in thermal tolerance .

In H. somni, HtpX is hypothesized to stabilize membrane integrity during host infection, though direct evidence remains under investigation .

Diagnostic Tool Development

Recombinant HtpX is commercially available as an ELISA antigen (e.g., Cusabio CSB-CF533887HTE) for antibody detection in bovine sera, aiding in H. somni infection diagnostics .

Vaccine Research

While no HtpX-based vaccines are yet marketed, recombinant outer membrane proteins (e.g., p31 and p40 in H. somni) have shown efficacy in experimental formulations, suggesting HtpX could be a candidate for future trials .

Mechanistic Studies

  • Protease Activity Assays: Purified recombinant HtpX cleaves casein and misfolded substrates in vitro, confirming its enzymatic function .

  • Gene Knockout Models: Comparative proteomics of htpX-deficient strains could clarify its role in bacterial pathogenesis .

Key Research Findings

StudyKey InsightSource
Stress-Induced ExpressionSubinhibitory tilmicosin upregulates htpX in H. parasuis, linking it to stress adaptation
Structural CharacterizationRecombinant HtpX retains zinc-dependent proteolytic activity post-refolding
Genomic ContexthtpX is conserved in H. somni strains, with homologs in pathogenic Pasteurellaceae

Future Directions

  • Pathogenicity Studies: Elucidate HtpX’s role in H. somni biofilm formation or host cell invasion .

  • Therapeutic Targeting: Develop HtpX inhibitors to disrupt bacterial stress responses during infection.

  • Diagnostic Optimization: Validate HtpX ELISA kits across diverse H. somni strains for clinical use .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you require a specific format, please clearly indicate your preference when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize development according to your specification.
Synonyms
htpX; HSM_1408; Protease HtpX; Heat shock protein HtpX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
htpX
Target Protein Sequence
MMRILLFLATNFAVLFVFNIILTLTGIQRQDAVGLLIFATLFGFTGSIISLLMSKSMALR SVNGQVIEQPRNETEHWLLQTVHSQAERAGLPMPTVAIYHSADVNAFATGATKKNSLVAV STGLLNAMTRDEAEAVLAHEVSHIKSGDMVTMTLLQGVLNTFVIFISRMLAKVVATDRDG NTSQGIYFMISMVLELVFGVLASMIAMWFSRYREFKADAGSAELVGKHKMIAALQRLKTL HEPQEMEGQLAAFAINGKRGGLASLFLSHPPLEKRIEALRNLDSLNGK
Uniprot No.

Target Background

Database Links

KEGG: hsm:HSM_1408

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is HtpX and what cellular role does it play in gram-negative bacteria?

HtpX is a membrane-bound zinc metalloprotease that participates in the proteolytic quality control of membrane proteins. In Escherichia coli, HtpX functions in conjunction with FtsH, a membrane-bound and ATP-dependent protease, to maintain membrane protein homeostasis . The protease is involved in the degradation pathway of misfolded or damaged membrane proteins, contributing to cellular stress responses. Evidence demonstrates that HtpX exhibits proteolytic activities against both membrane and soluble proteins, confirming its role in protein quality control mechanisms . This function appears to be conserved across various gram-negative bacterial species, including Haemophilus somnus, where homologs display similar membrane-associated proteolytic activity.

How does HtpX differ from other bacterial proteases in terms of structure and catalytic mechanism?

HtpX distinguishes itself from other bacterial proteases through its zinc-dependent endoprotease activity specifically localized to the membrane. Unlike cytoplasmic proteases that primarily target soluble proteins, HtpX is integrated into the membrane and can access membrane-spanning substrates . The enzyme's catalytic activity is strictly dependent on zinc ions (Zn²⁺), classifying it as a metalloprotease rather than a serine or cysteine protease. Biochemical characterization has shown that in the presence of zinc, HtpX can degrade casein (a model soluble substrate) and cleave the membrane protein SecY, demonstrating its versatility in substrate recognition . The protease also exhibits self-cleavage activity when supplemented with Zn²⁺, suggesting a potential autoregulatory mechanism that may control its cellular abundance.

What experimental approaches have been validated for detecting and measuring HtpX activity?

Several experimental approaches have been validated for detecting and measuring HtpX activity:

  • Self-cleavage assays: Purified HtpX undergoes self-degradation in the presence of zinc ions, which can be monitored by SDS-PAGE and quantified densitometrically to assess proteolytic activity .

  • Casein degradation assays: Using casein as a model substrate, researchers can measure the rate of casein hydrolysis spectrophotometrically to determine HtpX activity under various experimental conditions .

  • Membrane protein substrate cleavage: The ability of HtpX to cleave membrane proteins such as SecY can be monitored by western blotting using antibodies against the substrate protein .

  • In vivo validation: Overexpression systems involving both the protease and a potential substrate can confirm the ability of HtpX to cleave specific targets within the cellular environment .

The selection of an appropriate assay depends on the specific research question, with in vitro biochemical assays providing mechanistic insights and in vivo approaches offering physiological relevance.

Which expression systems are most effective for producing functional recombinant HtpX?

Based on experience with similar membrane proteases, E. coli-based expression systems offer promising platforms for producing recombinant HtpX. Drawing parallels from the successful expression of similar membrane proteins like H. somni OMP40, the E. coli C41 strain has demonstrated superior capabilities for expressing membrane-associated proteins . This strain, derived from the Origami line, was specifically designed for expressing toxic transmembrane proteins that might be difficult to produce in conventional expression hosts .

The choice of induction method significantly impacts protein yield. The autoinduction system has shown particular efficiency for membrane protein expression, eliminating the need for monitoring culture growth and manually adding inducers . This system often results in increased cell mass and higher target protein yields compared to conventional IPTG induction methods. For membrane proteases like HtpX, special consideration must be given to optimizing culture conditions to balance between high expression levels and proper protein folding.

What purification challenges are specific to HtpX and how can they be addressed?

Purification of HtpX presents several challenges characteristic of membrane-bound proteases:

  • Self-degradation: HtpX undergoes self-degradation upon cell disruption or membrane solubilization, complicating purification efforts . To address this, purification under denaturing conditions followed by refolding in the presence of a zinc chelator has been successfully employed .

  • Insolubility and inclusion body formation: Similar to other membrane proteins, HtpX tends to form inclusion bodies when overexpressed. While this can complicate purification, it may also be advantageous as it prevents the toxic effects of active protease during expression . Inclusion bodies can be solubilized using chaotropic agents such as urea or guanidine hydrochloride.

  • Maintaining stability during refolding: The addition of 10% glycerol has been shown to improve the solubility and stability of refolded membrane proteins similar to HtpX . Additionally, carefully controlled refolding in the presence of appropriate detergents can help recover properly folded and active enzyme.

  • Zinc-dependent activity: Since HtpX is a zinc-dependent metalloprotease, careful management of zinc availability during purification and refolding is critical for obtaining functionally active enzyme .

A strategic purification protocol would involve initial isolation under denaturing conditions to prevent self-degradation, followed by controlled refolding with appropriate additives to enhance stability and recovery of enzymatic activity.

How can researchers optimize refolding conditions to obtain active recombinant HtpX?

Optimizing refolding conditions for recombinant HtpX requires a systematic approach that addresses the protein's membrane origin and zinc dependency:

  • Controlled removal of denaturants: A gradual reduction in denaturant concentration (e.g., urea or guanidine hydrochloride) through dialysis or dilution prevents protein aggregation during refolding.

  • Zinc chelation during initial refolding: Refolding in the presence of a zinc chelator prevents premature activation and self-degradation . Once the protein has adopted its proper conformation, zinc can be reintroduced to restore enzymatic activity.

  • Detergent selection: The choice of detergent is critical for membrane protein refolding. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) often provide suitable environments for refolding membrane proteases.

  • Stabilizing additives: Addition of glycerol (typically 10%) has been shown to enhance the solubility and stability of refolded membrane proteins . Other stabilizing agents such as arginine or low concentrations of compatible osmolytes may further improve refolding efficiency.

  • Temperature control: Performing refolding at reduced temperatures (4-16°C) can minimize aggregation and improve the yield of correctly folded protein.

The success of refolding can be assessed by measuring the recovered proteolytic activity using established assay systems such as self-cleavage or degradation of model substrates like casein .

What are the essential controls needed in HtpX activity assays?

When designing experiments to assess HtpX activity, several essential controls must be included to ensure data reliability and interpretation:

  • Enzyme-free control: Substrate incubated under identical conditions but without HtpX to account for any spontaneous degradation or background signal.

  • Metal chelation control: HtpX incubated with substrate in the presence of a zinc-specific chelator (e.g., EDTA or TPEN) to confirm zinc dependency of the observed proteolytic activity .

  • Catalytic mutant control: A mutated version of HtpX with substitutions in the catalytic site to demonstrate that the observed activity is due to the specific proteolytic action of HtpX rather than contaminants.

  • Substrate specificity control: Including non-target proteins in the assay to demonstrate substrate selectivity of HtpX activity.

  • Time-course sampling: Collection of samples at multiple time points to establish the kinetics of substrate degradation and ensure measurements are made within the linear range of the assay.

These controls collectively provide a framework for rigorous experimental design that can yield reliable and reproducible data on HtpX activity under various experimental conditions.

How should researchers design experiments to investigate substrate specificity of HtpX?

Designing experiments to investigate HtpX substrate specificity requires a multi-faceted approach:

  • Candidate substrate selection: Begin with bioinformatic analysis to identify potential membrane protein substrates based on characteristics of known targets like SecY . Consider factors such as membrane topology, exposed cleavage sites, and protein abundance during stress conditions.

  • In vitro cleavage assays: Purify candidate substrates and incubate them with recombinant HtpX under controlled conditions. Analyze reaction products using SDS-PAGE, western blotting, or mass spectrometry to identify cleavage sites.

  • Site-directed mutagenesis: Modify potential cleavage sites in candidate substrates to determine the amino acid sequence requirements for HtpX recognition.

  • In vivo validation: Overexpress both HtpX and potential substrates in a suitable host system, then monitor substrate degradation through western blotting or pulse-chase experiments .

  • Comparative analysis: Compare degradation patterns across different substrates to identify common features that might constitute a recognition motif for HtpX.

This systematic approach allows for comprehensive characterization of HtpX substrate specificity, providing insights into both the mechanistic details of substrate recognition and the physiological roles of this protease in bacterial cells.

What are the key variables to control when comparing wild-type and mutant HtpX proteins?

  • Protein purity and concentration: Ensure that both wild-type and mutant proteins are purified to the same degree of homogeneity and quantified using identical methods. Normalize protein concentrations carefully across all experimental comparisons .

  • Buffer composition: Maintain identical buffer conditions (pH, ionic strength, detergent concentration) for all protein variants to eliminate potential confounding effects of the solution environment on protein activity .

  • Zinc concentration: Since HtpX is a zinc-dependent metalloprotease, ensure that a consistent concentration of zinc is present in all assays, or systematically vary zinc levels to evaluate potential differences in metal binding between wild-type and mutant proteins .

  • Temperature and incubation time: Conduct all assays at the same temperature and for identical time periods to ensure that any observed differences are due to intrinsic properties of the proteins rather than variations in assay conditions .

  • Substrate batch and concentration: Use the same preparation of substrate at equivalent concentrations across all experiments to eliminate substrate-related variables .

By systematically controlling these variables, researchers can confidently attribute observed differences in proteolytic activity to the specific amino acid changes introduced in the mutant proteins, enabling reliable structure-function analyses.

How can researchers apply knowledge of E. coli HtpX to understand homologous proteases in Haemophilus somnus?

Researchers can leverage knowledge of E. coli HtpX to investigate homologous proteases in Haemophilus somnus through comparative genomics and functional studies:

  • Sequence alignment and structural prediction: Align the amino acid sequences of E. coli HtpX and its H. somnus homolog to identify conserved catalytic residues, zinc-binding motifs, and transmembrane domains. Use homology modeling to predict the three-dimensional structure of the H. somnus protease based on available structural data for E. coli HtpX.

  • Heterologous expression systems: Express the H. somnus HtpX homolog in E. coli expression systems that have been successful for E. coli HtpX, such as the C41 strain with autoinduction protocols . Compare expression levels, solubility, and purification characteristics between the two proteins.

  • Complementation studies: Assess whether the H. somnus HtpX homolog can functionally complement an htpX deletion in E. coli, restoring wild-type phenotypes under stress conditions that typically require HtpX function.

  • Substrate specificity comparison: Determine whether the H. somnus HtpX recognizes the same substrates as E. coli HtpX (e.g., SecY) . Differences in substrate preferences could indicate species-specific adaptations in proteolytic quality control systems.

  • Immunological cross-reactivity assessment: Similar to studies with H. somni OMP40, investigate whether antibodies raised against one protease cross-react with the homolog from another species, providing insights into conserved epitopes .

This comparative approach can reveal both conserved mechanisms and species-specific adaptations in membrane protein quality control across different gram-negative bacteria.

What methodologies enable the identification of natural substrates of HtpX in bacterial systems?

Identifying the natural substrates of HtpX requires sophisticated methodologies that capture dynamic protease-substrate interactions within bacterial systems:

  • Quantitative proteomics: Compare the membrane proteome of wild-type bacteria versus htpX deletion mutants under various stress conditions using SILAC (Stable Isotope Labeling with Amino acids in Cell culture) or TMT (Tandem Mass Tag) approaches. Proteins that accumulate in the absence of HtpX represent potential substrates.

  • Substrate-trapping mutants: Generate catalytically inactive HtpX variants that can bind but not cleave substrates, effectively "trapping" them in a complex. These complexes can be isolated by affinity purification and the trapped substrates identified by mass spectrometry.

  • In vivo crosslinking: Use chemical crosslinkers to capture transient interactions between HtpX and its substrates within living cells. After crosslinking, HtpX can be purified under denaturing conditions and crosslinked partners identified.

  • Global protein stability profiling: Employ methods like Global Protein Stability (GPS) profiling to monitor changes in protein stability in the presence or absence of HtpX activity, identifying proteins whose turnover depends on this protease.

  • Degradomics: Apply N-terminomics approaches to identify specific cleavage sites generated by HtpX activity in vivo, which can be mapped back to substrate proteins.

These complementary approaches provide a comprehensive view of the HtpX substrate landscape, connecting this protease to specific cellular pathways and stress response mechanisms.

How can researchers investigate the potential role of HtpX in bacterial pathogenesis and host-pathogen interactions?

Investigating HtpX's role in bacterial pathogenesis requires methodologies that bridge molecular mechanisms with pathogen behavior in host environments:

  • Virulence assessment using deletion mutants: Generate htpX deletion mutants in Haemophilus somnus and assess changes in virulence using appropriate animal models. Compare colonization efficiency, persistence, and tissue damage caused by wild-type versus mutant strains.

  • Stress survival assays: Evaluate the ability of htpX mutants to survive host-relevant stresses (oxidative stress, antimicrobial peptides, temperature shifts) compared to wild-type bacteria. Reduced stress tolerance could indicate compromised virulence potential.

  • Host immune response analysis: Similar to studies with H. somni OMP40, investigate whether HtpX or its proteolytic products modulate host immune responses . Assess whether antibodies against HtpX demonstrate cross-reactivity with similar proteases from other gram-negative pathogens.

  • Transcriptomic analysis during infection: Compare gene expression profiles of wild-type and htpX mutant bacteria during infection to identify pathways affected by HtpX activity in the host environment.

  • Vaccine potential assessment: Drawing from research on H. somni OMP40, evaluate whether recombinant HtpX could serve as a vaccine antigen, inducing protective immunity against multiple gram-negative pathogens due to potential cross-reactivity .

Experimental ApproachApplication to HtpXExpected Outcome
Deletion mutant virulence testingCreate clean htpX knockout in H. somnusAssess contribution to pathogenicity
Host cell infection modelsCompare wild-type vs. htpX mutant interaction with host cellsDetermine role in adhesion, invasion, or intracellular survival
Immunization studiesVaccinate animal models with recombinant HtpXEvaluate protective efficacy against bacterial challenge
Cross-protection analysisChallenge immunized animals with heterologous pathogensAssess breadth of protection due to conserved epitopes

This multifaceted approach can reveal whether HtpX represents a potential therapeutic target or vaccine candidate for preventing infections caused by Haemophilus somnus and potentially other gram-negative pathogens.

How can researchers overcome inclusion body formation when expressing recombinant HtpX?

Inclusion body formation is a common challenge when expressing membrane proteins like HtpX. Researchers can employ several strategies to either prevent inclusion body formation or effectively recover active protein from inclusion bodies:

  • Prevention strategies:

    • Lower induction temperature (16-20°C) to slow protein synthesis and allow more time for proper folding

    • Reduce inducer concentration to decrease expression rate

    • Co-express molecular chaperones (e.g., GroEL/GroES, DnaK/DnaJ) to assist protein folding

    • Use specialized E. coli strains like C41 that are designed for toxic membrane protein expression

    • Add fusion partners that enhance solubility (e.g., SUMO, thioredoxin, or MBP)

  • Recovery strategies:

    • Solubilize inclusion bodies under denaturing conditions (6-8M urea or guanidine hydrochloride)

    • Purify denatured protein using immobilized metal affinity chromatography

    • Employ stepwise dialysis with decreasing denaturant concentration to allow gradual refolding

    • Add stabilizing agents like 10% glycerol to prevent aggregation during refolding

    • Include appropriate detergents to mimic the membrane environment during refolding

  • Hybrid approaches:

    • Direct extraction from membranes followed by detergent solubilization if a portion of the expressed protein integrates into bacterial membranes

    • Directed evolution or protein engineering to generate HtpX variants with improved solubility

These approaches can be systematically tested to determine the most effective strategy for obtaining functional recombinant HtpX.

What are the common pitfalls in measuring zinc-dependent protease activity and how can they be avoided?

Measuring zinc-dependent protease activity like that of HtpX presents several potential pitfalls that researchers should be aware of:

  • Zinc contamination: Trace amounts of zinc in buffers or water can activate the protease prematurely. Use high-purity reagents and consider treating buffers with metal chelating resins before adding controlled amounts of zinc.

  • Self-degradation: HtpX undergoes self-cleavage in the presence of zinc, which can complicate activity measurements over time . Optimize assay duration and conditions to minimize this effect, or account for it in calculations.

  • Non-specific inhibition by buffer components: Some buffer components can chelate zinc or otherwise interfere with proteolytic activity. Test multiple buffer systems and include appropriate controls to identify potential interference.

  • Substrate limitations: Using model substrates like casein may not accurately reflect the activity against physiological membrane protein substrates . When possible, validate findings using actual membrane protein substrates.

  • Detergent effects: The choice and concentration of detergents can significantly impact protease activity. Screen multiple detergents and optimize concentrations to find conditions that maintain both enzyme stability and activity.

A systematic approach to assay development, including careful control experiments and validation with multiple substrates, can help avoid these pitfalls and yield reliable measurements of HtpX activity.

What strategies can address the challenges of generating antibodies against membrane-bound proteases like HtpX?

Generating antibodies against membrane-bound proteases like HtpX presents unique challenges due to their hydrophobic nature and potential toxicity. Several strategies can be employed to overcome these obstacles:

  • Antigen design options:

    • Use purified recombinant full-length HtpX refolded in detergent micelles

    • Generate peptide antigens corresponding to predicted extracellular or periplasmic loops

    • Create fusion proteins containing the hydrophilic domains of HtpX

    • Employ synthetic peptides mimicking specific epitopes, particularly from catalytic domains

  • Immunization approaches:

    • Similar to strategies used for H. somni OMP40, use multiple small doses rather than fewer large doses to minimize potential toxicity

    • Employ appropriate adjuvants that enhance immunogenicity without causing excessive inflammation

    • Consider DNA immunization encoding HtpX to allow in vivo expression and proper folding

  • Screening and validation:

    • Test antibody reactivity against both native and denatured forms of the protein

    • Validate specificity using knockout mutants lacking htpX expression

    • Perform epitope mapping to confirm recognition of the intended protein regions

  • Alternative approaches:

    • If conventional antibody production proves challenging, consider nanobodies or single-chain antibodies, which may better recognize conformational epitopes in membrane proteins

    • Use epitope tagging of recombinant HtpX followed by detection with commercial tag antibodies

These strategies can be adapted based on specific research needs and the available resources for antibody production and validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.