Recombinant Haemophilus somnus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
crcB; HSM_1243; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
crcB
Target Protein Sequence
MNLFTHLFLISCGASLGAMSRHGLTLLLNPLFTFLSFGTLIANYIGCLIMGIMLAMFWHS SAFSTEYRLFFVTGFLGSLTTFSAFSAEVIENLLQHKWLEGITITSLHILGCLFFTTLGV FIWRYFQ
Uniprot No.

Target Background

Function
Crucial in reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: hsm:HSM_1243

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus and what significance do its outer membrane proteins have in research?

Haemophilus somnus (now referred to as Histophilus somni) is a Gram-negative bacterium that causes significant multisystemic diseases in beef and dairy cattle. It is considered an opportunistic pathogen that can lead to substantial economic losses in the cattle industry. The bacterium's outer membrane proteins (OMPs) play pivotal roles in cellular survival and host-bacterium interactions, making them key targets for immunological research and vaccine development .

Among these proteins, the OMP40 (approximately 40 kDa) has been identified as a porin with significant homology between its N-terminal amino acid sequence and porins of other gram-negative bacteria. This protein shows particular significance as it demonstrates cross-reactivity with similar antigens in other bacterial species, suggesting its potential as a broad-spectrum vaccine candidate .

What expression systems are most effective for producing recombinant H. somni proteins?

Based on systematic evaluation of various expression systems, the most effective approach for producing recombinant H. somni proteins, particularly OMP40, involves using specialized E. coli strains designed for membrane protein expression. Studies have demonstrated that while most common host E. coli strains (such as BL21, C43, and R. gami) expressed very low amounts of recombinant OMP40 or none at all, the E. coli C41 strain showed the highest overexpression across all tested culture conditions .

For induction methods, the autoinduction system proved most efficient for producing recombinant H. somni OMP40, likely because this system is specifically designed for high-level protein expression with the pET system. The autoinduction approach offers significant advantages as it eliminates the need to monitor culture growth and manually add inducers, often resulting in increased cell mass and target protein yield .

How can researchers overcome solubility challenges when expressing recombinant H. somni membrane proteins?

Membrane proteins like H. somni OMP40 present particular challenges regarding solubility. Research demonstrates that these proteins can be isolated from both soluble and insoluble cytoplasmic fractions, with inclusion bodies forming a significant portion of the expressed protein. Several methodological approaches can improve solubility:

  • Addition of stabilizing agents: The addition of 10% glycerol to purification buffers significantly improves the solubility of recombinant OMP40, counteracting the hydrophobic nature of membrane proteins .

  • Expression system optimization: While using the pET system with signal sequences for periplasmic translocation theoretically enhances solubility, this approach showed limited success with H. somni OMP40 .

  • Temperature modification: Prolonged IPTG induction at lower temperatures (16 hours at room temperature) represents a commonly attempted strategy, though this approach alone was insufficient for OMP40 .

  • Specialized host strains: Using E. coli strains like R. gami, which are permissive for disulfide bond formation in the cytoplasm, represents another approach, though this also had limited success with OMP40 .

Interestingly, for toxic membrane proteins like OMP40, the formation of inclusion bodies can sometimes be advantageous, as the protein may not inhibit cell growth when present in this inactive form .

What methodological considerations are critical when evaluating the immunogenic properties of recombinant H. somni proteins in animal models?

Evaluating immunogenic properties of recombinant H. somni proteins requires a multifaceted approach addressing both humoral and cellular immune responses. Based on research with recombinant OMP40, the following methodological considerations are critical:

Humoral response evaluation:

  • Antibody subclass analysis: Measurements should include specific antibody subclasses (IgG1, IgG2, IgM) to characterize the type of immune response. Research with rOMP40 demonstrated significant increases in IgG1 (P ≤ 0.01) and IgG2 (P ≤ 0.01, after first immunization only) but not IgM .

  • Cross-reactivity assessment: ELISA and Western blotting should be employed to assess cross-reactivity with surface antigens of related bacterial species. For rOMP40, increased reactivity of IgG against surface antigens of E. coli and Pasteurella multocida was observed after second immunization (P < 0.01) .

  • Dose determination: Careful consideration of antigen dosage is essential - studies with rOMP40 successfully used 20 μg per animal in calves .

Cell-mediated immune response assessment:

  • Delayed-type hypersensitivity (DTH) testing: Intradermal injection of the antigen can evaluate cell-mediated immune responses. For rOMP40, the strongest DTH reaction was observed 24-48 hours after injection, consistent with expected timelines for this response .

  • Adjuvant selection: The choice of adjuvant significantly impacts both humoral and cellular responses - rOMP40 emulsified with Emulsigen successfully elicited measurable DTH reactions .

  • Timing considerations: Cell-mediated responses should be measured at multiple time points (24, 48, 72 hours) to capture the peak inflammatory reaction .

How does the molecular characterization of recombinant H. somni proteins impact understanding of cross-species reactivity?

Molecular characterization of recombinant H. somni proteins provides critical insights into cross-species reactivity patterns. For OMP40, sequence analysis and structural studies revealed several important aspects:

  • Sequence homology: The N-terminal amino acid sequence of H. somni OMP40 shows significant homology with porins from other gram-negative bacteria, including Actinobacillus actinomycetemcomitans OMP39, P. multocida OmpH, H. influenzae P2, and E. coli OmpC .

  • Molecular mass variation: The molecular mass of MOMP (Major Outer Membrane Protein) can vary considerably among different H. somni strains, ranging from 32.914 kDa (strain 129Pt) to 40.439 kDa (strain 540). These proteins maintain common epitopes despite size variations .

  • Strain-specific expression patterns: Pathogenic H. somni strains, particularly those isolated from bovine thromboembolic meningoencephalitis (TEME) and pneumonia, typically express MOMP with a molecular mass of approximately 40 kDa. In contrast, asymptomatic carrier strains often have a truncated MOMP of about 33 kDa .

This molecular characterization directly correlates with observed cross-reactivity patterns. Anti-rOMP40 antibodies recognize antigens with molecular masses of approximately 40 ± 2 kDa from members of the Pasteurellaceae and Enterobacteriaceae families, suggesting conserved immunogenic epitopes across these bacterial groups .

What optimized PCR protocols are effective for amplifying H. somnus protein genes for recombinant expression?

Based on successful amplification of the H. somni OMP40 gene, the following optimized PCR protocol has proven effective:

Reaction components:

  • 1× buffer

  • 500 μM dNTP mix

  • 400 nM of each primer (with incorporated restriction enzyme sites)

  • 2% DMSO (critical for GC-rich templates)

  • 2.5 units of high-fidelity polymerase (Accu Taq Polymerase)

  • 1-5 μL of purified bacterial DNA

Thermal cycling conditions:

  • Initial denaturation: 10 minutes at 94°C

  • 30 cycles of:

    • Denaturation: 15 seconds at 94°C

    • Annealing: 30 seconds at 52°C

    • Extension: 90 seconds at 68°C

  • Final extension: 10 minutes at 68°C

Primer design considerations:

  • Incorporation of restriction enzyme sites (NcoI and XhoI) for directional cloning

  • Addition of extra nucleotides to maintain reading frame (e.g., three extra nucleotides encoding glycine were added to avoid reading frame shift at the N-terminus)

This protocol successfully amplified the approximately 1143 bp fragment of the OMP40 gene (accession number LC160262.1), which was subsequently cloned into the pET 22b(+) expression vector .

What are the most effective expression and purification strategies for recombinant H. somni membrane proteins?

Based on experimental data, the following expression and purification strategies have proven most effective for recombinant H. somni membrane proteins:

Expression optimization:

Expression ParameterOptimal ConditionComparative Effectiveness
Host strainE. coli C41Significantly superior to BL21, C43, and R. gami strains
Induction methodAutoinduction systemHigher yield than IPTG induction
TemperatureRoom temperature for extended periodsBetter than higher temperature induction
VectorpET 22b(+) with appropriate signal sequencesEnables both cytoplasmic expression and potential periplasmic targeting
Additives10% glycerol in buffersCritical for maintaining solubility

Purification considerations:

  • Cellular fraction selection: Both soluble and insoluble cytoplasmic fractions contain the target protein, with insoluble fractions often yielding higher amounts .

  • Inclusion body processing: For membrane proteins like OMP40, purification from inclusion bodies can be advantageous and yield significant amounts of protein .

  • Buffer composition: The addition of 10% glycerol to purification buffers is essential for maintaining protein solubility during and after purification .

  • Expression verification: Analytical techniques including SDS-PAGE and Western blotting with specific antibodies should be employed to confirm successful expression and purification .

How do amino acid sequence variations in H. somnus proteins correlate with immunogenicity and cross-reactivity?

Research on H. somni OMP40 has revealed important correlations between amino acid sequence variations and immunogenic properties:

  • Sequence conservation and variation: Comparison of amino acid sequences of the recombinant OMP40 construct with sequences available in the BLAST database revealed 99% sequence conformity with H. somni reference sequences. Analysis identified specific variations at positions 2, 304, and 328 compared to reference sequences (e.g., glycine addition, glutamic acid to arginine change, and glutamic acid to glycine change, respectively) .

  • Molecular mass correlation with pathogenicity: H. somni strains expressing MOMP with molecular masses of approximately 40 kDa are typically more pathogenic and associated with conditions like bovine thromboembolic meningoencephalitis and pneumonia. Conversely, asymptomatic carrier strains often express truncated MOMP of approximately 33 kDa .

  • Epitope conservation across species: Despite sequence variations, certain epitopes remain conserved across related bacterial species, explaining the observed cross-reactivity of anti-rOMP40 antibodies with approximately 40 kDa antigens from other gram-negative bacteria of the Pasteurellaceae and Enterobacteriaceae families .

This understanding of sequence-function relationships is critical for designing broadly protective vaccine candidates and predicting potential cross-protection against related pathogens.

How should researchers interpret cross-reactivity data when evaluating recombinant H. somnus proteins as vaccine candidates?

When evaluating cross-reactivity data for recombinant H. somni proteins as vaccine candidates, researchers should consider multiple interpretative frameworks:

  • Cross-protection potential: Cross-reactivity with antigens from other gram-negative bacteria suggests potential broad-spectrum protection. For instance, anti-rOMP40 antibodies recognized antigens with molecular masses of approximately 40 ± 2 kDa from members of both Pasteurellaceae and Enterobacteriaceae families, indicating possible protection against multiple pathogens .

  • Evolutionary conservation significance: Cross-reactivity patterns provide insights into evolutionarily conserved structural elements across bacterial species. The homology between H. somni OMP40 and porins from other gram-negative bacteria (A. actinomycetemcomitans OMP39, P. multocida OmpH, H. influenzae P2, and E. coli OmpC) indicates conservation of critical structural elements .

  • Mechanistic implications: Cross-reactivity data should be interpreted in the context of known protective mechanisms. For example, antibodies against porin proteins of H. influenzae, Neisseria gonorrhoeae, and Salmonella typhimurium have demonstrated bactericidal and protective effects, suggesting similar mechanisms might apply to anti-OMP40 antibodies .

  • Validation requirements: While immunological cross-reactivity is promising, researchers must confirm functional cross-protection through appropriate challenge studies to determine if the observed antibody responses translate to actual protection against heterologous pathogens .

What statistical approaches are most appropriate for analyzing immunological responses to recombinant H. somni proteins?

When analyzing immunological responses to recombinant H. somni proteins, several statistical approaches have proven effective:

  • Paired statistical tests for pre-post immunization comparisons: For evaluating antibody responses before and after immunization, paired statistical tests that account for individual variation are most appropriate. Studies with rOMP40 used such tests to demonstrate significant increases in specific antibody subclasses (IgG1, IgG2) after immunization (P ≤ 0.01) .

  • Multiple time point analysis: Statistical models that accommodate repeated measures are essential when evaluating responses at multiple time points (e.g., primary vs. booster immunization responses, or DTH reactions at 24, 48, and 72 hours) .

  • Cross-reactivity quantification: When evaluating cross-reactivity with multiple bacterial species, approaches that can handle multiple comparisons while controlling for family-wise error rate are critical .

  • Significance thresholds: Most immunological studies with recombinant H. somni proteins use P ≤ 0.01 or P ≤ 0.05 as significance thresholds, with the more stringent P ≤ 0.01 often applied to primary outcomes .

  • Graphical representation: Box plots, scatter plots with means and standard deviations, and line graphs for time-course data provide effective visualization of immunological response data and facilitate interpretation of statistical findings .

What genomic approaches could enhance the identification and characterization of novel H. somnus immunogens?

The genomic sequencing of multiple H. somnus strains provides powerful opportunities for identifying and characterizing novel immunogens. Several promising approaches include:

  • Comparative genomics: Analysis of genomes from virulent versus avirulent H. somnus strains can identify genetic determinants associated with pathogenicity and immunogenicity. The completed sequencing of two H. somnus strains has already facilitated the identification of genes responsible for distinctive attributes within this species and related bacteria .

  • Reverse vaccinology: This genome-based approach identifies potential vaccine candidates through computational analysis of bacterial genomes, focusing on predicted surface-exposed or secreted proteins that may serve as effective immunogens .

  • Transcriptomic profiling: RNA-seq analysis of H. somnus under various growth conditions (particularly those mimicking in vivo environments) can identify differentially expressed genes that may encode important immunogens expressed during infection .

  • Structural genomics: Combining genomic data with structural biology approaches can help predict protein structure and function, facilitating the identification of potentially immunogenic epitopes and informing recombinant protein design .

  • Pangenome analysis: Examining the complete gene repertoire across multiple H. somnus isolates can identify core and accessory genomes, helping distinguish conserved immunogens (potential broad-spectrum targets) from strain-specific antigens .

These genomic approaches, combined with traditional immunological methods, hold significant promise for identifying novel H. somnus immunogens beyond the currently characterized outer membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.