Recombinant Haemophilus somnus UPF0283 membrane protein HS_0596 (HS_0596)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
HS_0596; UPF0283 membrane protein HS_0596
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Haemophilus somnus (strain 129Pt) (Histophilus somni)
Target Names
HS_0596
Target Protein Sequence
MPKKVFQQEDVEQKITENFEPKQEFEQDELDIEMDCSQFETTMDRQNTDIPFQHMVRPKV TMWQKLLMATICLFSCGILAQSVQWLVDSWRDNQWIAFVFAMVSLFLVLLGLGAIIKEWR RLVQLKKRLILQEKSREIRSKSAVNLTEVSSEGKELCLKIASLMGIDDKSPQLIAWQEQV HEAYTEQEILRLFSQNVLIPFDRVAKKLISKNAVESALIVAVSPLAIVDMFFIAWRNIRL INQLAKLYGIELGYVSRLRLLRMVFVNMAFAGAADVIQDLGLEWLSQDITAKLSARVAQG IGVGILTARLGIKAMEFCRPIAVAPEEKLRLSHIQTELLGTLKTTLFSANKVKEKVR
Uniprot No.

Target Background

Database Links

KEGG: hso:HS_0596

STRING: 205914.HS_0596

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Haemophilus somnus UPF0283 membrane protein HS_0596 and what is its significance in research?

Haemophilus somnus UPF0283 membrane protein HS_0596 (also referred to as HS_0596) is a 357-amino acid membrane protein encoded by the HS_0596 gene in Histophilus somni (formerly known as Haemophilus somnus). This protein belongs to the UPF0283 protein family and is of particular interest because it is expressed in a bacterial pathogen responsible for causing various bovine diseases, including thrombotic meningoencephalitis, respiratory diseases, septicemia, abortion, arthritis, and myocarditis .

The significance of this protein lies in understanding its potential role in H. somni pathogenesis and host-pathogen interactions. Research on HS_0596 contributes to our knowledge of bacterial membrane proteins in general, and specifically to understanding virulence mechanisms in H. somni infections .

How is recombinant HS_0596 typically produced for research purposes?

Recombinant HS_0596 protein is typically produced using E. coli expression systems. The full-length sequence (amino acids 1-357) is cloned into an expression vector with an N-terminal His-tag to facilitate purification. The expression construct is then transformed into E. coli, where the protein is expressed under controlled conditions .

After expression, the protein is purified using affinity chromatography techniques that utilize the His-tag. The purified protein is then typically lyophilized for stability and storage. For research applications, the lyophilized protein can be reconstituted in an appropriate buffer (often Tris/PBS-based buffer with 6% Trehalose, pH 8.0) to a concentration of 0.1-1.0 mg/mL .

The addition of 5-50% glycerol is recommended for long-term storage, with a final concentration of 50% glycerol being commonly used. Properly prepared, the protein can be stored at -20°C or -80°C, with care taken to avoid repeated freeze-thaw cycles .

How does HS_0596 potentially contribute to Histophilus somni virulence and pathogenesis?

The role of HS_0596 in H. somni virulence is not fully characterized, but several lines of evidence suggest potential contributions to pathogenesis. H. somni is known to undergo antigenic and structural phase variation in its lipooligosaccharide (LOS), which contributes to immune evasion and virulence . While HS_0596 itself is not directly implicated in LOS biosynthesis, it may function within membrane complexes that support bacterial adaptation during infection.

H. somni causes vascular inflammation leading to thrombotic meningoencephalitis (TME) and activates bovine platelets, which subsequently induce endothelial cell pro-inflammatory responses. This process involves the expression of adhesion molecules (ICAM-1, E-selectin), tissue factor, and cytokines (IL-1β, MCP-1, MIP-1α) . As a membrane protein, HS_0596 may participate in host-pathogen interactions that trigger these inflammatory cascades.

H. somni's virulence factors include:

  • Ability to form biofilms

  • Acquisition of iron as a nutrient

  • Binding of host immunoglobulins through outer membrane proteins (OMPs)

  • Genetic variability in surface antigens

  • Phase variation capabilities

While direct evidence linking HS_0596 to these mechanisms is limited, its membrane localization makes it a candidate for involvement in one or more of these processes .

What experimental approaches are most effective for studying protein-protein interactions involving HS_0596?

Several complementary approaches can be employed to study protein-protein interactions involving HS_0596:

A comprehensive approach would employ multiple methods to cross-validate interactions and distinguish between direct and indirect associations .

What is known about antimicrobial resistance in relation to H. somni, and how might HS_0596 be involved?

Specific resistance rates in respiratory isolates include:

  • Oxytetracycline: 28.3%

  • Kanamycin: 24.5%

  • Ampicillin: 24.5%

  • Amoxicillin: 13.2%

  • Nalidixic acid: 1.9%

  • Danofloxacin: 1.9%

Regarding resistance mechanisms, several antimicrobial resistance genes have been identified in H. somni:

  • blaROB-1: Associated with resistance to ampicillin and amoxicillin

  • aphA-1: Associated with kanamycin resistance

  • tetH/tetR: Associated with oxytetracycline resistance

  • strA/strB: Associated with streptomycin resistance

While HS_0596 has not been directly implicated in antimicrobial resistance, as a membrane protein, it could potentially contribute to membrane permeability or efflux systems that affect drug entry or extrusion. Additionally, membrane proteins can be part of stress response systems that help bacteria survive antimicrobial exposure .

The distribution of antimicrobial resistance genes in H. somni appears to be associated with specific genetic lineages, suggesting that resistance determinants may spread via integrative and conjugative elements (ICEs) within certain bacterial populations .

What are the optimal experimental conditions for functional studies of recombinant HS_0596?

Designing functional studies for recombinant HS_0596 requires careful consideration of protein stability, solubility, and biological activity. Based on available data and general principles for membrane protein research, the following experimental conditions are recommended:

Buffer Composition:

  • Base buffer: Tris/PBS-based buffer, pH 8.0

  • Stabilizers: 6% Trehalose

  • For long-term storage: 50% glycerol (final concentration)

Temperature Considerations:

  • Storage temperature: -20°C to -80°C for stock solutions

  • Working aliquots: 4°C for up to one week

  • Experimental temperature: 25-37°C (depending on specific assay)

Reconstitution Protocol:

  • Centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for storage

  • Prepare small aliquots to avoid repeated freeze-thaw cycles

Experimental Considerations:

  • For membrane protein functional studies, consider incorporating HS_0596 into liposomes or nanodiscs to maintain native-like membrane environment

  • For interaction studies, ensure that the His-tag does not interfere with potential binding domains; if necessary, include a control with the tag cleaved

  • Include appropriate positive and negative controls specific to the functional assay being performed

How should researchers design experiments to study the role of HS_0596 in H. somni pathogenesis?

A comprehensive experimental design to investigate HS_0596's role in H. somni pathogenesis should incorporate multiple approaches:

1. Genetic Manipulation Approach:

  • Generate HS_0596 knockout mutants using homologous recombination or CRISPR-Cas techniques

  • Create complemented strains to verify phenotypes

  • Develop strains with tagged HS_0596 for localization studies

2. In Vitro Infection Models:

  • Compare wild-type and HS_0596 mutant strains in:

    • Adhesion assays with bovine endothelial cells

    • Invasion assays with relevant host cells

    • Biofilm formation assays

    • Resistance to serum killing

    • Resistance to phagocytosis

3. Ex Vivo Studies:

  • Evaluate interactions with bovine immune cells and platelets

  • Assess cytokine induction profiles

  • Examine effects on endothelial cell activation

4. In Vivo Studies:

  • Use appropriate animal models (preferably bovine) to compare:

    • Colonization efficiency

    • Disease progression

    • Inflammatory responses

    • Tissue tropism

5. Molecular Interaction Studies:

  • Identify host receptors or targets using pull-down assays

  • Confirm interactions using techniques like surface plasmon resonance

  • Characterize binding domains through mutational analysis

This experimental design follows standard approaches in experimental research, including proper controls, variable definition, and hypothesis testing .

Experimental ApproachKey Variables to ControlExpected Outcomes
Genetic ManipulationGrowth conditions, expression levelsPhenotypic changes related to virulence
In Vitro ModelsCell passage number, multiplicity of infectionDifferences in adhesion, invasion, or survival
Ex Vivo StudiesBlood donor variability, incubation timeAltered immune activation profiles
In Vivo StudiesAnimal age, inoculation dose, routeChanges in disease progression or bacterial load
Molecular StudiesProtein purity, buffer conditionsIdentification of specific interaction partners

What controls and variables should be considered when designing experiments involving recombinant HS_0596?

Independent Variables:

  • Concentration of recombinant HS_0596

  • Experimental conditions (temperature, pH, buffer composition)

  • Presence of potential interacting molecules

  • Duration of exposure/incubation

Dependent Variables:

  • Protein binding/interaction measurements

  • Cellular responses (e.g., cytokine production, adhesion molecule expression)

  • Functional outcomes specific to experimental hypothesis

Control Groups:

  • Negative Controls:

    • Buffer-only treatments

    • Irrelevant recombinant protein of similar size/structure

    • Heat-denatured HS_0596 protein

  • Positive Controls:

    • Known stimulus that induces the expected response

    • Well-characterized protein with similar function (if available)

  • Additional Controls:

    • His-tag only protein to control for tag effects

    • Endotoxin control to ensure observed effects are not due to LPS contamination

Experimental Design Considerations:

  • Use randomization to assign treatments

  • Include technical and biological replicates

  • Consider blinding during data analysis when possible

  • Calculate appropriate sample sizes based on expected effect sizes

  • Control for batch effects in protein preparation

Potential Confounding Variables:

  • Endotoxin contamination during protein preparation

  • Protein aggregation or misfolding

  • Buffer components that may affect the system under study

  • Variation in cell culture conditions or animal models

This approach aligns with best practices in experimental design as outlined in the search results, particularly the need to clearly define variables, control for confounding factors, and include appropriate controls to validate findings .

What are the main challenges in expressing and purifying recombinant HS_0596, and how can they be addressed?

Expression and purification of membrane proteins like HS_0596 present several technical challenges. Based on general principles of membrane protein biochemistry and specific information about HS_0596, these challenges and their solutions include:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for the expression host; consider using specialized E. coli strains designed for membrane protein expression such as C41(DE3) or C43(DE3).

  • Approach: Test different promoter strengths and induction conditions (temperature, inducer concentration, duration).

Challenge 2: Protein Insolubility and Inclusion Body Formation

  • Solution: Lower induction temperature (16-20°C), reduce inducer concentration, or use fusion partners that enhance solubility (e.g., MBP, SUMO).

  • Approach: If inclusion bodies form, develop a refolding protocol or switch to a membrane-based extraction approach.

Challenge 3: Maintaining Protein Stability During Purification

  • Solution: Use stabilizing additives in buffers (e.g., glycerol, specific lipids, trehalose).

  • Approach: Minimize exposure to detergents by optimizing extraction conditions and purification speed.

Challenge 4: Protein Heterogeneity

  • Solution: Use size exclusion chromatography as a final purification step to isolate homogeneous protein populations.

  • Approach: Verify protein quality by SDS-PAGE, western blotting, and mass spectrometry.

Challenge 5: Maintaining Native-like Conformation

  • Solution: Consider reconstitution into nanodiscs, liposomes, or amphipols after purification.

  • Approach: Verify proper folding using circular dichroism or limited proteolysis.

Recommended Purification Protocol:

  • Express in E. coli with optimized conditions (16-20°C, 0.1-0.5 mM IPTG)

  • Extract membrane fraction using differential centrifugation

  • Solubilize membranes using mild detergents (DDM, LMNG, or digitonin)

  • Purify using Ni-NTA affinity chromatography with imidazole gradient elution

  • Apply size exclusion chromatography for final purification

  • Consider reconstitution into membrane mimetics for functional studies

This approach incorporates best practices for membrane protein purification while addressing the specific properties of HS_0596 .

How can researchers overcome difficulties in studying membrane protein interactions involving HS_0596?

Studying membrane protein interactions presents unique challenges due to the hydrophobic nature of these proteins and their native lipid environment. Several strategies can overcome these difficulties:

Challenge 1: Maintaining Native Conformation

  • Solution: Use membrane mimetics such as nanodiscs, liposomes, or styrene-maleic acid lipid particles (SMALPs) that preserve the lipid environment.

  • Approach: Compare results across different membrane mimetic systems to ensure consistency.

Challenge 2: Non-specific Interactions Due to Hydrophobicity

  • Solution: Include appropriate detergents or lipids in binding buffers and increase stringency in washing steps.

  • Approach: Use crosslinking approaches that capture specific interactions before extraction from membranes.

Challenge 3: Low Signal-to-Noise Ratio in Detection

  • Solution: Employ amplification techniques such as proximity ligation assays or utilize highly sensitive detection methods like fluorescence resonance energy transfer (FRET).

  • Approach: Design experiments with appropriate controls to distinguish specific from non-specific signals.

Challenge 4: Difficulties in Distinguishing Direct from Indirect Interactions

  • Solution: Use techniques that detect direct interactions such as crosslinking mass spectrometry or biolayer interferometry with purified components.

  • Approach: Validate interactions using multiple independent techniques.

Recommended Approaches for HS_0596 Interaction Studies:

  • Proximity-based labeling (BioID or APEX2):

    • Fuse HS_0596 to a proximity labeling enzyme

    • Express in native host or relevant model system

    • Identify labeled proteins by mass spectrometry

    • Validate top candidates with independent methods

  • Crosslinking coupled with mass spectrometry:

    • Apply membrane-permeable crosslinkers to intact cells

    • Purify HS_0596 complexes under denaturing conditions

    • Analyze crosslinked peptides by mass spectrometry

    • Map interaction sites at amino acid resolution

  • Microscopy-based approaches:

    • Use split fluorescent proteins to visualize interactions in living cells

    • Apply super-resolution microscopy to map protein co-localization

    • Employ single-molecule tracking to analyze dynamic interactions

These approaches incorporate advances in membrane protein research methodology while addressing the specific challenges associated with studying proteins like HS_0596 .

What analytical methods are most effective for characterizing the structure-function relationship of HS_0596?

Understanding the structure-function relationship of HS_0596 requires a multi-faceted analytical approach that combines structural characterization with functional assays. The following methods are particularly effective:

Structural Characterization Methods:

  • Cryo-Electron Microscopy (cryo-EM):

    • Particularly valuable for membrane proteins that are difficult to crystallize

    • Can achieve near-atomic resolution structures in native-like environments

    • Sample preparation involves reconstitution in nanodiscs or vitrification in detergent micelles

  • X-ray Crystallography:

    • Requires successful crystallization, which can be challenging for membrane proteins

    • Lipidic cubic phase (LCP) crystallization may be particularly suitable

    • Provides high-resolution structural data when successful

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Solution NMR for smaller domains or solid-state NMR for full-length protein

    • Can provide dynamic information not available from static structures

    • Useful for mapping interaction sites and conformational changes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides information on protein dynamics and solvent accessibility

    • Useful for identifying regions involved in interactions or conformational changes

    • Does not require crystallization or isotope labeling

  • Computational Modeling:

    • Homology modeling based on related proteins with known structures

    • Molecular dynamics simulations to study dynamics in membrane environment

    • Integration with experimental data for model validation

Functional Characterization Methods:

  • Site-Directed Mutagenesis:

    • Systematic mutation of key residues identified from structural studies

    • Functional testing of mutants to identify essential regions

    • Correlation of structural features with functional outcomes

  • Domain Mapping:

    • Expression of isolated domains to identify functional units

    • Truncation analysis to define minimal functional regions

    • Chimeric proteins to test domain specificity

  • Binding and Activity Assays:

    • Surface plasmon resonance or microscale thermophoresis for binding kinetics

    • Fluorescence-based assays for monitoring conformational changes

    • Cell-based assays to assess biological activity in context

Integrated Approach:

The most effective strategy integrates structural and functional data through an iterative process:

  • Initial computational modeling to predict structure

  • Low-resolution experimental structural characterization

  • Identification of potential functional regions

  • Mutational analysis and functional testing

  • Refinement of structural models based on functional data

  • Higher-resolution structural studies focused on key regions

This approach leverages the complementary strengths of different analytical methods to build a comprehensive understanding of HS_0596 structure-function relationships .

What are the most promising research directions for understanding the biological role of HS_0596 in H. somni pathogenesis?

Based on current knowledge of H. somni pathogenesis and the properties of HS_0596, several research directions show particular promise:

These research directions build on current understanding of H. somni pathogenesis while focusing specifically on elucidating the role of HS_0596 .

How might comparative studies between HS_0596 and related proteins in other bacterial species inform research approaches?

Comparative studies between HS_0596 and related proteins can significantly enhance research approaches and generate new hypotheses. Key aspects of such comparative studies include:

  • Evolutionary Conservation Analysis:

    • Identify highly conserved regions that may indicate functional importance

    • Map sequence conservation onto structural models to identify surface-exposed conserved patches

    • Compare conservation patterns between pathogenic and non-pathogenic species

  • Functional Conservation Testing:

    • Determine if homologs from different species can complement HS_0596 knockout phenotypes

    • Identify species-specific functional adaptations

    • Correlate sequence differences with host specificity or virulence capabilities

  • Structural Comparison Approaches:

    • Leverage existing structural data from better-characterized homologs

    • Use homology modeling to predict HS_0596 structure based on solved structures

    • Identify structural motifs associated with specific functions

  • Comparative Genomic Context:

    • Analyze gene neighborhood conservation across species

    • Identify co-evolved gene clusters that may participate in common pathways

    • Map operon structures to infer functional relationships

  • Host-Interaction Comparative Studies:

    • Compare binding specificities to host factors across species

    • Investigate whether related proteins target similar host pathways

    • Identify species-specific adaptations to different host environments

The UPF0283 protein family, to which HS_0596 belongs, is found in various bacterial species, and related transmembrane proteins like TMEM14A in humans show sequence similarity . Comparing HS_0596 with these proteins can provide insights into both conserved functions and pathogen-specific adaptations.

This comparative approach can be particularly valuable given the limited direct information about HS_0596, allowing researchers to leverage findings from better-characterized homologs .

What emerging technologies or methodologies might advance research on HS_0596 and other bacterial membrane proteins?

Several emerging technologies show particular promise for advancing research on bacterial membrane proteins like HS_0596:

  • Cryo-Electron Tomography (cryo-ET):

    • Enables visualization of membrane proteins in their native cellular context

    • Can be combined with subtomogram averaging for structural determination

    • Particularly valuable for studying protein complexes in intact bacterial membranes

  • Single-Particle cryo-EM with Enhanced Detectors:

    • Next-generation detectors improve resolution for smaller membrane proteins

    • New sample preparation techniques reduce preferred orientation issues

    • Could enable atomic-resolution structures of HS_0596 without crystallization

  • Integrative Structural Biology Approaches:

    • Combining multiple experimental datasets (cryo-EM, crosslinking-MS, HDX-MS)

    • Computational integration to generate comprehensive structural models

    • Particularly powerful for dynamic or flexible membrane proteins

  • Advanced Mass Spectrometry Techniques:

    • Native MS for intact membrane protein complexes

    • Ion mobility MS for conformational analysis

    • Targeted proteomics for quantification in complex samples

  • Artificial Intelligence and Machine Learning:

    • Improved structure prediction (building on AlphaFold2 advances)

    • Automated image analysis for cryo-EM data

    • Prediction of protein-protein interactions and functional sites

  • Genome Editing Technologies:

    • CRISPR-Cas systems optimized for bacterial pathogens

    • Precise genome editing for structure-function studies

    • High-throughput mutagenesis coupled with functional screening

  • Advanced Imaging Technologies:

    • Super-resolution microscopy for protein localization studies

    • Live-cell imaging with minimal tags

    • Correlative light and electron microscopy for integrating functional and structural data

  • Microfluidics and Organ-on-a-Chip:

    • Controlled host-pathogen interaction studies

    • Real-time monitoring of infection processes

    • Testing of multiple conditions with minimal sample requirements

These emerging technologies can address current limitations in membrane protein research and provide new insights into the structure, function, and biological role of HS_0596 and related proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.