Recombinant Haemophilus somnus UPF0283 membrane protein HSM_0945 (HSM_0945)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSM_0945; UPF0283 membrane protein HSM_0945
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Histophilus somni (strain 2336) (Haemophilus somnus)
Target Names
HSM_0945
Target Protein Sequence
MPKKVFQQEDVEQKITENFEPKQEFEQDELDIEMDCSQFETTMDRQNTDIPFQHMVRPKV TMWQKLLMATICLFSCGILAQSVQWLVDSWRDNQWIAFVFAMVSLFLVLLGLGTIIKEWR RLVQLKKRLILQEKSREIRSKSAVNLTEVSSEGKELCLKIASLMGIDDKSPQLIAWQEQV HEAYTEQEILRLFSQNVLIPFDRVAKKLISKNAVESALIVAVSPLAIVDMFFIAWRNIRL INQLAKLYGIELGYVSRLRLLRMVFVNMAFAGAAEVIQDLGLEWLSQDITAKLSARVAQG IGVGILTARLGIKAMEFCRPIAVAPEEKLRLSHIQTELLGTLKTTLFSANKVKEKVR
Uniprot No.

Target Background

Database Links

KEGG: hsm:HSM_0945

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental approaches are used to study the genetic context of HSM_0945?

Several complementary approaches can be used to understand the genetic context of HSM_0945:

  • Genomic analysis: Analyzing the flanking regions of the HSM_0945 gene to identify potential operons or gene clusters.

  • Transcriptomic profiling: RNA sequencing under various growth conditions to identify co-transcribed genes and regulatory patterns.

  • Restriction endonuclease analysis (REA): A technique used for H. somnus strains that can reveal genetic relationships between isolates carrying the gene .

  • Ribotyping: Analysis of rRNA gene restriction fragment length polymorphisms that can be used to characterize genetic relationships between strains .

Methodology example: When performing REA-typing, researchers typically:

  • Extract chromosomal DNA from cultured H. somnus isolates

  • Digest with restriction enzymes (commonly Taq1 for H. somnus)

  • Separate fragments by gel electrophoresis

  • Compare resulting patterns to identify related strains

Studies have shown that H. somnus isolates from pneumonia cases often display similar REA patterns, suggesting clonal relationships that may influence HSM_0945 expression and function .

What are the optimal recombinant expression systems for HSM_0945?

Based on available research data, the following expression systems have been documented for recombinant HSM_0945:

Expression SystemTagBuffer ConditionsStorage RecommendationsYieldNotes
E. coliN-terminal His tagTris/PBS-based buffer, pH 8.0, 6% Trehalose-20°C/-80°C; avoid repeated freeze-thaw cyclesNot specifiedMost commonly used system
E. coliVariable (determined during production)Tris-based buffer, 50% glycerol-20°C (extended storage at -20°C or -80°C)~50 μg/batchOptimized for protein stability

For optimal expression:

  • Maintain culture at 37°C until induction, then reduce to 18-25°C to enhance proper folding

  • Use IPTG concentrations between 0.1-0.5 mM for induction

  • Allow expression to continue for 16-18 hours post-induction

  • Include membrane-stabilizing agents in lysis buffers

  • Solubilize using mild detergents appropriate for membrane proteins

How is Haemophilus somnus taxonomically classified and what is its significance?

Haemophilus somnus, now formally reclassified as Histophilus somni, is a gram-negative, pleomorphic bacterium that is an important pathogen in cattle. Its taxonomic classification is:

  • Domain: Bacteria

  • Phylum: Proteobacteria

  • Class: Gammaproteobacteria

  • Order: Pasteurellales

  • Family: Pasteurellaceae

  • Genus: Histophilus

  • Species: H. somni (formerly H. somnus)

The bacterium is significant as a causative agent of multiple disease manifestations in cattle, including pneumonia, septicemia, reproductive tract infections, and thrombotic meningoencephalitis . Epidemiological studies have revealed distinct strain differences between isolates from different anatomical sites, with pneumonia isolates often showing greater genetic similarity to each other than to genital tract isolates .

How does iron restriction affect the expression of outer membrane proteins in H. somnus, and what are the implications for HSM_0945?

Iron restriction significantly alters the outer membrane protein (OMP) profile of Haemophilus somnus, inducing the expression of several iron-regulated proteins. Research using ethylenediamine-di-O-hydroxyphenyl acetic acid (EDDA) to create iron-restricted growth conditions has revealed:

  • Most H. somnus strains induce expression of multiple outer membrane proteins under iron restriction .

  • The number and molecular weights of induced proteins vary between strains, suggesting strain-specific adaptation mechanisms .

  • Western blot analysis shows immunological relatedness among iron-regulated proteins across strains, though certain iron-regulated proteins in some strains are not recognized by hyperimmune serum .

Methodological approach for studying HSM_0945 under iron restriction:

  • Culture H. somnus in media containing EDDA at concentrations ranging from 25-100 μM

  • Extract outer membrane proteins using sarkosyl differential solubilization

  • Analyze protein expression via SDS-PAGE and Western blotting

  • Quantify HSM_0945 expression using densitometry or targeted proteomics

  • Compare expression levels with non-iron-restricted controls

These findings have significant implications for HSM_0945 research, suggesting that its expression may be modulated by iron availability, potentially playing a role in the bacterium's adaptation to iron-limited host environments. The lack of recognition of certain iron-regulated proteins by hyperimmune serum also suggests potential immune evasion mechanisms that could involve membrane proteins like HSM_0945 .

What bioinformatic approaches would be most effective for predicting HSM_0945 structure and function?

Given the uncharacterized nature of HSM_0945, comprehensive bioinformatic analysis would involve:

  • Sequence-based predictions:

    • Transmembrane topology prediction using TMHMM, Phobius, or TOPCONS

    • Signal peptide detection using SignalP

    • Conserved domain identification using InterPro, PFAM, or CDD

    • Secondary structure prediction using PSIPRED or JPred

  • Structure prediction:

    • AlphaFold2 or RoseTTAFold for tertiary structure prediction

    • Molecular dynamics simulations to assess structural stability in membrane environments

    • Protein-protein interaction interface prediction

  • Comparative analyses:

    • PSI-BLAST or HHpred searches for remote homologs

    • Phylogenetic analysis of UPF0283 family proteins across bacterial species

    • Genomic context analysis across Pasteurellaceae to identify conserved gene neighborhoods

  • Functional inference:

    • Analysis of co-expression networks

    • Protein subcellular localization prediction

    • Integrative approaches combining structural features with expression patterns

The predicted structures should be validated experimentally using methods such as circular dichroism, limited proteolysis, or crosslinking studies before proceeding to more detailed functional analyses.

How do variations in HSM_0945 correlate with strain differences in H. somnus and potential tissue tropism?

H. somnus isolates show considerable strain variation that may reflect adaptation to different host tissues. Analysis of 105 strains revealed:

  • 21 different biotypes based on sugar fermentation patterns

  • 33 distinct restriction endonuclease analysis (REA) patterns

  • 16 different ribopatterns

  • 12 distinct plasmid profiles among the 22 isolates containing plasmids

Notably, 78% of Danish isolates from pneumonia cases belonged to the same REA and ribotype, suggesting a predominant clone associated with respiratory disease. In contrast, strains from the genital tract generally showed limited homology to pneumonia isolates . This suggests that specific genetic variants, potentially including variations in membrane proteins like HSM_0945, may contribute to tissue tropism.

To investigate HSM_0945's role in tissue tropism:

  • Compare HSM_0945 sequences across pneumonia and genital isolates

  • Assess expression levels in different tissue environments using RT-qPCR

  • Create isogenic mutants with HSM_0945 variants and test for altered tissue adherence

  • Perform comparative proteomics of outer membrane fractions from different isolates

This multi-faceted approach would help determine whether HSM_0945 variability contributes to the observed tissue-specific adaptation of H. somnus strains.

What are the challenges in determining protein-protein interactions involving HSM_0945?

Investigating protein-protein interactions for membrane proteins like HSM_0945 presents several challenges:

  • Solubilization issues: Membrane proteins require detergents for solubilization, which can disrupt native interactions.

  • Expression level variability: Environmental conditions, such as iron availability, can significantly alter expression levels of outer membrane proteins in H. somnus .

  • Strain-dependent variations: Different H. somnus strains show considerable variation in protein expression profiles , complicating cross-strain comparisons.

  • Technical limitations: Traditional co-immunoprecipitation approaches may not preserve weak or transient interactions.

A comprehensive methodology for studying HSM_0945 interactions would include:

  • Chemical crosslinking followed by mass spectrometry: This approach captures interactions in their native environment before solubilization.

  • Bacterial two-hybrid systems: Modified for membrane protein analysis using split-ubiquitin or BACTH systems.

  • Proximity-based labeling: Using techniques like BioID or APEX2 fused to HSM_0945 to identify proximal proteins in living bacteria.

  • Surface plasmon resonance (SPR): For validating direct interactions with purified components.

Each technique has strengths and limitations, necessitating a multi-method approach for reliable interaction mapping.

What quality control methods are essential for recombinant HSM_0945 preparations?

Ensuring high-quality recombinant HSM_0945 preparations requires rigorous quality control:

Quality ParameterMethodAcceptance CriteriaImportance
PuritySDS-PAGE with silver staining>90% purityEssential for functional studies and preventing confounding factors
IdentityWestern blot, Mass spectrometryConfirmation of expected mass and epitope reactivityValidates protein identity
Endotoxin levelsLAL assay<0.1 EU/μg proteinCritical for immunological studies
Proper foldingCircular dichroism, tryptophan fluorescenceConsistent secondary structure profilesIndicates functional conformation
Aggregation stateSize exclusion chromatography, dynamic light scatteringPredominantly monomeric or native oligomeric stateEnsures homogeneity of preparation
Functional activityBinding assays, functional reconstitutionApplication-dependentConfirms biological relevance

Additional considerations specific to membrane proteins:

  • Detergent concentration should be monitored to ensure it remains above critical micelle concentration

  • Lipid content analysis may be necessary if protein function depends on specific lipid interactions

  • Freeze-thaw stability should be assessed, as membrane proteins are often sensitive to repeated freeze-thaw cycles

How should researchers design experiments to study HSM_0945 involvement in host-pathogen interactions?

A comprehensive experimental design for investigating HSM_0945's role in host-pathogen interactions would include:

  • Gene knockout and complementation studies:

    • Create HSM_0945 deletion mutants using allelic exchange

    • Complement with wild-type and variant HSM_0945 constructs

    • Assess phenotypic changes in bacterial adherence, invasion, and survival in host cells

  • Host cell interaction models:

    • Develop bovine cell line models (e.g., bovine respiratory epithelial cells)

    • Compare wild-type and HSM_0945-deficient strains for adherence and invasion efficiency

    • Assess host cell responses, including cytokine production and signaling pathway activation

  • Animal infection models:

    • Utilize established bovine infection models

    • Compare tissue distribution and persistence of wild-type vs. mutant strains

    • Analyze immune responses to determine if HSM_0945 modulates host immunity

  • Controls and variables to consider:

    • Include multiple H. somnus strains to account for strain variation

    • Test under varying iron conditions, given the importance of iron regulation in H. somnus virulence

    • Include complemented mutants to confirm phenotypes are due to HSM_0945 loss

    • Consider growth rate differences between strains when interpreting results

This multi-level approach would provide robust evidence for HSM_0945's role in H. somnus pathogenesis and host interaction.

What are the best approaches for functional characterization of HSM_0945?

Given the uncharacterized nature of HSM_0945, a systematic functional characterization would involve:

  • Subcellular localization confirmation:

    • Immunogold electron microscopy to visualize HSM_0945 localization

    • Membrane fractionation and Western blotting

    • Protease accessibility assays to determine membrane topology

  • Interaction identification:

    • Pull-down assays with tagged HSM_0945

    • Cross-linking mass spectrometry

    • Bacterial two-hybrid screening

  • Transport function assessment:

    • Liposome reconstitution and permeability assays

    • Ion flux measurements in proteoliposomes

    • Substrate binding assays

  • Signaling pathway involvement:

    • Phosphorylation state analysis

    • Second messenger level measurement upon overexpression/deletion

    • Pathway-specific reporter assays

  • Virulence contribution:

    • Immune evasion assays

    • Adhesion to host cell studies

    • Survival under stress conditions (iron limitation, oxidative stress)

Each aspect requires appropriate controls, including:

  • Empty vector controls

  • Inactive mutant versions (e.g., point mutations in predicted functional domains)

  • Heterologous expression in non-pathogenic bacteria to assess gain-of-function

How can researchers leverage comparative genomics to understand HSM_0945 evolution and function?

Comparative genomics offers powerful insights into HSM_0945 evolution and potential function:

  • Phylogenetic analysis workflow:

    • Identify HSM_0945 homologs across bacterial species using BLAST and HMM searches

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Map key functional residues and domains onto the phylogeny

  • Synteny analysis:

    • Examine gene neighborhood conservation across Pasteurellaceae

    • Identify co-evolving genes that may participate in the same pathway

    • Analyze operon structures that include HSM_0945 homologs

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under purifying or positive selection

    • Identify rapidly evolving sites that may indicate host adaptation

    • Compare selection patterns between strains from different tissues

  • Structure-based comparisons:

    • Map sequence conservation onto predicted structures

    • Identify conserved surface patches that may indicate interaction interfaces

    • Compare structural features with functionally characterized proteins

This approach has successfully revealed functions of previously uncharacterized proteins and could provide valuable insights into HSM_0945's role in H. somnus biology and pathogenesis.

What statistical approaches are recommended for analyzing HSM_0945 expression data across different experimental conditions?

When analyzing HSM_0945 expression across different conditions (e.g., iron restriction, different growth phases, or host environments), researchers should employ these statistical approaches:

  • For RT-qPCR data:

    • Normalize to multiple reference genes validated for stability across experimental conditions

    • Apply the 2^(-ΔΔCt) method for relative quantification

    • Use ANOVA with post-hoc tests for multi-condition comparisons

    • Apply non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

  • For proteomics data:

    • Normalize using global intensity normalization or spike-in standards

    • Apply LIMMA or MSstats for differential expression analysis

    • Control for multiple testing using Benjamini-Hochberg FDR correction

    • Validate key findings with targeted Western blotting

  • For time-course experiments:

    • Consider repeated measures ANOVA or mixed effects models

    • Apply time-series specific methods such as EDGE for temporal pattern identification

    • Cluster temporal profiles to identify co-regulated genes

  • Data visualization:

    • Present expression data in tables with appropriate statistical measures

    • Use consistent formatting for clarity as recommended in scientific publication guidelines

    • Include heat maps for multi-condition comparisons

    • Provide clear figure legends explaining normalization and statistical methods

Example data presentation format:

ConditionHSM_0945 Expression (Fold Change ± SEM)p-valueFDR-corrected p-value
Normal iron1.00 ± 0.12--
Iron restriction (25 μM EDDA)3.42 ± 0.380.00240.0096
Iron restriction (50 μM EDDA)5.67 ± 0.510.00030.0018
Iron restriction (100 μM EDDA)7.89 ± 0.64<0.00010.0006

What are the best practices for presenting HSM_0945 structural data in research publications?

When presenting structural data for HSM_0945 in publications, researchers should follow these best practices:

  • Primary structure presentation:

    • Provide the complete amino acid sequence with key domains highlighted

    • Include multiple sequence alignments with homologs to highlight conserved regions

    • Present hydropathy plots to illustrate transmembrane domains

  • Secondary structure data:

    • Display circular dichroism spectra with appropriate controls

    • Include tables summarizing predicted secondary structure content

    • Compare experimental data with bioinformatic predictions

  • Tertiary structure models:

    • Present multiple views of predicted structures, highlighting key features

    • Include quality assessment metrics (e.g., AlphaFold pLDDT scores)

    • Compare models generated by different methods (AlphaFold2, RoseTTAFold, etc.)

    • Visualize membrane positioning using programs like MEMSAT or PPM

  • Experimental validation:

    • Present data from structure validation experiments (e.g., crosslinking, mutagenesis)

    • Include control experiments demonstrating specificity

    • Provide raw data in supplementary materials for reproducibility

Guidelines for effective structural data tables, based on scientific publication principles :

  • Use consistent formatting throughout tables

  • Provide descriptive titles that explain what data is presented

  • Include all necessary details in footnotes

  • Present numerical data with appropriate significant figures

  • Organize data logically to facilitate comparisons

  • Include statistical analyses where appropriate

These practices ensure clear communication of structural findings and enable other researchers to build upon the results in future studies.

How should researchers integrate findings from multiple experimental approaches to develop a comprehensive model of HSM_0945 function?

Developing a comprehensive functional model for HSM_0945 requires integrating diverse experimental datasets:

  • Data triangulation framework:

    • Systematically compare findings from bioinformatic predictions, structural studies, and functional assays

    • Identify convergent evidence supporting specific functional hypotheses

    • Document and investigate contradictory findings rather than dismissing them

    • Assess the strength of evidence for each functional aspect

  • Integration methodology:

    • Create a hierarchical evidence framework, weighting direct experimental evidence over predictions

    • Use Bayesian approaches to update confidence in functional models as new data emerges

    • Develop testable models that integrate all available evidence

    • Clearly distinguish between established facts and speculative aspects of the model

  • Visualization tools:

    • Create pathway or network diagrams showing HSM_0945's interactions and functional relationships

    • Use consistent visual language across different data types

    • Provide multiple representations at different levels of detail

  • Model validation strategy:

    • Design experiments specifically to test integrated models

    • Prioritize tests of predictions where different data sources disagree

    • Update models iteratively as validation results become available

Example of an integrated data presentation approach:

Functional AspectBioinformatic EvidenceStructural EvidenceExperimental EvidenceConfidence Level
Membrane localization3 TMD predictions; signal peptide detectedHydrophobic surfaces aligned with membraneFractionation confirms membrane associationHigh
Iron-responsive regulationIron-box motif in promoter regionN/A3.5-fold upregulation under iron restrictionMedium
Host cell adhesionStructural similarity to adhesinsExposed adhesion-like domainsReduced adhesion in knockout strainsMedium
Transporter activityHomology to ion transportersChannel-like central cavityNo direct experimental validationLow

This integrated approach ensures a comprehensive understanding of HSM_0945 function while maintaining scientific rigor and transparency about evidence quality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.