Recombinant Hahella chejuensis ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ftsH; HCH_04046; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
ftsH
Target Protein Sequence
MSNTDPQPPQKLPLNWVVWTLAVALMLYYLPAMRDRPEPAIKLPYSEFRMLLREGQISSV TLRGSELDGKFITPRMFPEQRRQYSRFLTQLPDFGNEAILAELEEQNIPLEVKEGHDASS SKVILLSYLPWIMFMIILFWLSRRTFRNFSGRGGAFDFDKRLETQFECQKPDTTFDEVAG QTNAKREVQELVEYLRDPDRFHRVGALAPRGVLLMGPPGTGKTLLARALAGEAGVNFYPM SASEFIEVFVGVGASRVRQLFKIAKENSPSIIFIDELDSVGRTRGAGYGGGHDEREQTLN QILAEMDGFAGHDAVIVLAATNRPDVLDPALMRPGRFDRHVTLDLPDQEGRVAILKVHAR HIPLADDVNLNQVAAGTPGFSGADLKNLINEAAIQAARENRDHVHSLDFDIARDKIIMGA ERTLIIPPDEKHRLAVHESGHTLVAYYLPNTDPLYKVSIVPHGRSLGGTHQLPLQERHTY PEEYLRDKLAVMLAGRIAERELLGSVSTGADDDIHQATGLARAMVSRWGMSKEVGPVDLR DSEEHPFLGREMAQPHHHSEFSAEIIDKAVRELLVAAETTAADLISTHREKLDRLVALLE RSETLHKAQIDECLQTGAS
Uniprot No.

Target Background

Function
This recombinant *Hahella chejuensis* ATP-dependent zinc metalloprotease FtsH (ftsH) acts as a processive, ATP-dependent zinc metallopeptidase targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Hahella chejuensis and why is it significant for FtsH research?

Hahella chejuensis is a marine bacterium isolated from the coastal area of Marado in South Korea that has attracted attention primarily due to its lytic activity against the red-tide dinoflagellate Cochlodinium polykrikoides. This bacterium produces prodigiosin, a red pigment with algicidal, immunosuppressive, and anticancer properties . While H. chejuensis is well-studied for its prodigiosin biosynthesis pathway (the hap gene cluster), its ATP-dependent zinc metalloprotease FtsH represents an important but less explored aspect of its cellular machinery. The study of FtsH in this organism provides unique opportunities to understand how this protease functions in marine bacterial systems, potentially revealing adaptations specific to marine environments and contributing to our broader understanding of protein quality control mechanisms in bacteria.

What specific domains characterize the FtsH protein in bacteria like H. chejuensis?

The ATP-dependent zinc metalloprotease FtsH in bacteria typically contains three conserved structural domains. First, a transmembrane domain anchors the protein in the membrane. Second, an AAA+ ATPase domain provides energy through ATP hydrolysis for substrate unfolding and translocation. Third, a zinc metalloprotease domain with the characteristic HEXXH motif coordinates the zinc ion essential for proteolytic activity . In H. chejuensis, these domains would likely be conserved, though with potential adaptations to marine environmental conditions. Researchers exploring H. chejuensis FtsH should conduct domain mapping experiments using limited proteolysis combined with mass spectrometry to precisely define domain boundaries, which is critical for designing recombinant constructs that retain proper folding and activity.

How should experiments be designed to study recombinant H. chejuensis FtsH expression?

When designing experiments to study recombinant H. chejuensis FtsH expression, researchers should employ a Completely Randomized Design (CRD) if the experimental material is homogeneous . The experimental units (expression cultures) should be randomly assigned to different treatment conditions to minimize bias. For FtsH expression, key experimental factors to consider include:

  • Expression systems (e.g., E. coli strains optimized for membrane protein expression)

  • Induction conditions (temperature, inducer concentration, induction time)

  • Media composition (especially considering the marine origin of H. chejuensis)

  • Codon optimization strategies

Each condition should be replicated at least 3-6 times to account for biological variability . The layout might look like:

TreatmentReplicationsExperimental Units
E. coli BL21(DE3)55 cultures
E. coli C41(DE3)55 cultures
E. coli Rosetta-gami55 cultures
E. coli Lemo21(DE3)55 cultures

Expression levels should be quantified using standardized methods such as western blotting with densitometry analysis to allow for statistical comparison between conditions using ANOVA.

What replication strategies and controls are necessary for studying H. chejuensis FtsH activity?

For studying H. chejuensis FtsH activity, proper replication and controls are essential to ensure valid and reliable results. Replication should involve repetition of the entire experimental procedure, not just technical replicates of the same sample . For enzymatic activity assays, the following controls should be included:

  • Negative controls:

    • Heat-inactivated FtsH enzyme

    • Reaction mixture without ATP

    • Reaction mixture with zinc chelators (e.g., EDTA)

    • Mutant FtsH with substitutions in the active site

  • Positive controls:

    • Well-characterized FtsH from model organisms (e.g., E. coli FtsH)

    • Known FtsH substrates with established degradation patterns

The experimental error, defined as the unexplained random variation, can be estimated and minimized through sufficient replication . A minimum of 4-5 biological replicates is recommended, with each experiment performed on different days using freshly prepared reagents to account for day-to-day variations. Statistical power analysis should be performed to determine the appropriate sample size needed to detect biologically meaningful differences in enzymatic activity.

How can randomization and local control principles be applied to FtsH purification protocols?

Applying randomization and local control principles to FtsH purification protocols is essential for obtaining reliable and unbiased results. Randomization involves randomly assigning treatments to experimental units to distribute any uncontrolled variability . For FtsH purification, researchers should:

  • Randomize the order in which different batches are processed

  • Randomize the assignment of different purification methods to bacterial cultures

  • Implement a blocked design if purifications must be performed across multiple days

Local control can be applied by:

  • Using a Randomized Complete Block Design (RCBD) when variations exist among purification equipment or reagent lots

  • Grouping similar experimental units into blocks to reduce experimental error

  • Ensuring each treatment appears once in each block

For example, when testing different detergents for solubilizing recombinant FtsH:

Block (Day)Treatment 1 (DDM)Treatment 2 (LDAO)Treatment 3 (Triton X-100)Treatment 4 (Digitonin)
Day 1Culture ACulture BCulture CCulture D
Day 2Culture ECulture FCulture GCulture H
Day 3Culture ICulture JCulture KCulture L

What expression systems are optimal for recombinant H. chejuensis FtsH production?

The selection of an optimal expression system for recombinant H. chejuensis FtsH production requires careful consideration of the protein's characteristics as a membrane-bound metalloprotease. Based on experience with similar proteins, several expression systems can be evaluated systematically:

  • E. coli-based systems:

    • BL21(DE3) derivatives such as C41(DE3) and C43(DE3) are engineered specifically for membrane protein expression

    • Lemo21(DE3) allows tunable expression through rhamnose concentration adjustment

    • ArcticExpress strains for low-temperature expression to improve folding

  • Yeast systems:

    • Pichia pastoris for expression of complex membrane proteins with proper folding

    • Saccharomyces cerevisiae for functional expression with eukaryotic modifications

When adapting the H. chejuensis ftsH gene for heterologous expression, researchers should consider codon optimization based on the expression host. A methodological approach would involve cloning the same gene construct into multiple expression vectors with different promoters (T7, tac, araBAD) and fusion tags (His6, MBP, SUMO) to identify the combination that yields the highest amount of correctly folded, active protein. Expression trials should test various induction temperatures (16°C, 25°C, 30°C) and inducer concentrations to optimize conditions that favor proper folding over high expression levels.

What purification strategy yields functional recombinant H. chejuensis FtsH?

A successful purification strategy for functional recombinant H. chejuensis FtsH requires careful consideration of its membrane-bound nature and metalloprotease activity. The following multi-step approach has proven effective for similar metalloproteases:

  • Membrane fraction isolation:

    • Cellular lysis using French press or sonication in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions (40,000-100,000 × g)

  • Solubilization optimization:

    • Screen detergents (DDM, LDAO, FC-12) at different concentrations

    • Include stabilizing agents (glycerol 10-20%, zinc chloride 10-50 μM)

  • Affinity chromatography:

    • IMAC using Ni-NTA or TALON resin for His-tagged constructs

    • Buffer containing reduced detergent concentration and zinc supplementation

  • Ion exchange chromatography:

    • Anion exchange (Q-Sepharose) to separate contaminants

    • Salt gradient elution (50-500 mM NaCl)

  • Size exclusion chromatography:

    • Final polishing step to isolate homogeneous hexameric complexes

    • Analysis of oligomeric state compared to known FtsH proteins

Throughout purification, samples should be monitored for ATPase activity using a colorimetric phosphate release assay to track functional protein recovery. Researchers should maintain 10-20 μM zinc in all buffers to prevent loss of the catalytic metal and consider including ATP or non-hydrolyzable ATP analogs (AMP-PNP) to stabilize the hexameric assembly. This methodological approach focuses on preserving the native structure and function of the protease rather than maximizing yield alone.

How can researchers verify the integrity and activity of purified recombinant H. chejuensis FtsH?

Verification of integrity and activity for purified recombinant H. chejuensis FtsH requires a comprehensive suite of analytical techniques:

  • Structural integrity verification:

    • SDS-PAGE and western blotting to confirm molecular weight and purity

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Thermal shift assays to evaluate protein stability

    • Dynamic light scattering to verify homogeneity and oligomeric state

  • Functional verification:

    • ATPase activity measurement using malachite green phosphate detection system

    • Proteolytic activity assays using known FtsH substrates (such as σ32, LpxC, or fluorogenic peptides)

    • Zinc-binding analysis using inductively coupled plasma mass spectrometry (ICP-MS)

A quantitative activity assay for FtsH should be established with the following parameters:

ParameterOptimal ConditionAcceptable Range
pH8.07.5-8.5
Temperature37°C30-42°C
ATP concentration2 mM1-5 mM
Zinc concentration50 μM10-100 μM
Substrate concentrationVariable based on substrateDetermine Km value

Activity should be expressed as specific activity (μmol product/min/mg protein) and compared with well-characterized FtsH from other bacterial sources like E. coli. Native gel electrophoresis under non-denaturing conditions can further verify the formation of the characteristic hexameric complex essential for FtsH function. Researchers should also confirm metal content using atomic absorption spectroscopy to verify the zinc:protein stoichiometry.

How does the regulatory role of H. chejuensis FtsH compare to that in other bacterial systems?

The regulatory role of H. chejuensis FtsH likely shares fundamental similarities with other bacterial systems but may exhibit unique characteristics related to its marine environment. In E. coli and other well-studied bacteria, FtsH regulates cellular processes through selective protein degradation, particularly of membrane proteins and misfolded proteins . For H. chejuensis, researchers should investigate:

  • Substrate specificity comparison:

    • Identify potential H. chejuensis FtsH substrates through proteomics approaches

    • Compare degradation kinetics with E. coli FtsH using common substrates

    • Explore marine-specific adaptations in substrate recognition

  • Stress response regulation:

    • Examine FtsH involvement in salt stress adaptation (particularly relevant for marine bacteria)

    • Test heavy metal stress responses, considering findings from other metalloprotease studies

    • Investigate temperature stress response mechanisms

  • Role in prodigiosin production:

    • Given H. chejuensis is known for prodigiosin production, explore potential connections between FtsH activity and the hap gene cluster regulation

    • Test whether FtsH affects components of two-component signal transduction systems like HapXY that regulate prodigiosin biosynthesis

A methodological approach would involve creating a conditional FtsH depletion strain in H. chejuensis (using techniques like CRISPR interference) and performing comparative transcriptomics and proteomics to identify differentially expressed genes and proteins. This would reveal regulatory networks dependent on FtsH activity that may be unique to this marine bacterium compared to terrestrial counterparts.

What methodologies are most effective for studying the membrane association of H. chejuensis FtsH?

Studying the membrane association of H. chejuensis FtsH requires specialized techniques that preserve the native membrane environment while allowing detailed biochemical and biophysical analysis. The following methodologies are particularly effective:

  • Fractionation and localization studies:

    • Differential centrifugation to separate membrane fractions

    • Sucrose density gradient ultracentrifugation to isolate specific membrane compartments

    • Western blot analysis with compartment-specific markers as controls

  • Membrane topology determination:

    • Protease accessibility assays using proteases that cannot cross membranes

    • Reporter fusion constructs (PhoA/LacZ) to map transmembrane segments

    • Site-directed fluorescence labeling at predicted loops

  • Lipid interaction studies:

    • Liposome floating assays with different lipid compositions

    • Microscale thermophoresis to measure binding affinities to specific lipids

    • Native nanodiscs incorporation for structural studies

  • Advanced imaging techniques:

    • Fluorescence microscopy with GFP-tagged FtsH to visualize cellular localization

    • Super-resolution microscopy to observe nanoscale organization

    • Electron microscopy of immunogold-labeled FtsH

These techniques should be applied systematically, beginning with basic fractionation to confirm membrane association, followed by detailed topology mapping and lipid interaction studies. Researchers should compare findings with known characteristics of E. coli FtsH while considering potential adaptations in H. chejuensis FtsH that might reflect its marine bacterial origin, such as modified transmembrane domains for different membrane fluidity requirements.

How can researchers accurately measure the ATP dependency of H. chejuensis FtsH activity?

Accurately measuring the ATP dependency of H. chejuensis FtsH activity requires carefully designed assays that can distinguish between ATP binding, hydrolysis, and coupling to proteolytic function. A comprehensive methodological approach includes:

  • ATPase activity measurement:

    • Colorimetric phosphate release assays (malachite green method)

    • Coupled enzyme assays (pyruvate kinase/lactate dehydrogenase system)

    • Radioactive [γ-32P]ATP hydrolysis tracking

  • ATP binding studies:

    • Isothermal titration calorimetry to determine binding constants

    • Fluorescent ATP analogs (TNP-ATP) for binding site characterization

    • UV cross-linking with [α-32P]ATP followed by peptide mapping

  • Coupling analysis between ATP hydrolysis and proteolysis:

    • Parallel monitoring of ATP consumption and substrate degradation

    • Time-course experiments with varying ATP concentrations

    • Use of non-hydrolyzable ATP analogs (ATPγS, AMP-PNP) as controls

A detailed ATP dependency experiment would involve:

ATP Concentration (mM)Proteolytic Activity (% of maximum)ATPase Activity (nmol Pi/min/mg)
00-50-5
0.110-2015-25
0.540-6045-65
1.070-8075-85
2.090-10090-100
5.095-10095-100
5.0 + EDTA0-50-5

This approach allows researchers to generate Michaelis-Menten kinetics for both ATP hydrolysis and proteolytic activity, determining parameters such as Km for ATP and the coupling efficiency between ATP hydrolysis and proteolysis. Researchers should also investigate whether H. chejuensis FtsH exhibits any unique properties in ATP utilization compared to other bacterial FtsH proteins, possibly related to adaptations to its marine environment.

How can comparative genomics approaches enhance understanding of H. chejuensis FtsH evolution?

Comparative genomics approaches offer powerful insights into the evolution and functional adaptations of H. chejuensis FtsH. Researchers should implement the following methodological strategies:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees using FtsH sequences from diverse bacterial phyla

    • Compare H. chejuensis FtsH with both marine and terrestrial bacteria

    • Identify clade-specific sequence signatures that might correlate with ecological niches

  • Synteny analysis:

    • Examine gene neighborhoods around ftsH in H. chejuensis and related species

    • Identify conserved gene clusters that might suggest functional associations

    • Compare with the organization observed in E. coli and other model organisms

  • Selection pressure analysis:

    • Calculate Ka/Ks ratios across different domains of the protein

    • Identify sites under positive selection that might indicate adaptive evolution

    • Compare conserved motifs across marine bacteria versus terrestrial counterparts

  • Domain architecture comparison:

    • Analyze conservation of transmembrane, ATPase, and protease domains

    • Identify marine-specific modifications in domain organization

    • Compare with the organization of FtsH proteins in plants and wheat, which have expanded FtsH families

Researchers should use these analyses to generate hypotheses about functional adaptations of H. chejuensis FtsH that could be experimentally tested. For instance, if certain residues in the transmembrane domain show signatures of positive selection in marine bacteria, site-directed mutagenesis could be used to test whether these residues confer adaptation to high-salt environments or specific membrane compositions found in marine habitats.

What approaches are effective for studying the role of H. chejuensis FtsH in stress response pathways?

Studying the role of H. chejuensis FtsH in stress response pathways requires multifaceted approaches that combine genetic manipulation, physiological assays, and molecular analyses. Effective methodological strategies include:

  • Gene expression modulation:

    • CRISPR interference (CRISPRi) for conditional knockdown of ftsH expression

    • Overexpression systems with inducible promoters

    • Site-directed mutagenesis to create catalytically inactive variants

  • Stress exposure experiments:

    • Heavy metal stress tests mimicking those used in wheat FtsH studies

    • Salt concentration gradient challenges relevant to marine environments

    • Temperature shift experiments (heat and cold shock)

    • Oxidative stress induced by hydrogen peroxide or paraquat

  • Global response analysis:

    • RNA-Seq transcriptomics under various stress conditions with and without functional FtsH

    • Quantitative proteomics to identify accumulated substrates in FtsH-depleted cells

    • Metabolomics to detect changes in cellular metabolism during stress response

  • Reporter systems:

    • Stress-responsive promoter fusions to fluorescent proteins

    • Real-time monitoring of stress response pathway activation

A systematic experimental design would involve subjecting wild-type H. chejuensis and FtsH-depleted strains to increasing levels of specific stressors while monitoring growth rates, survival, and molecular responses. For example, a heavy metal stress experiment might follow this design:

StrainCdCl₂ ConcentrationGrowth RateStress Response Gene ExpressionFtsH Substrate Accumulation
Wild-type0 mM100%BaselineBaseline
Wild-type0.1 mM80-90%2-3 fold increaseMinimal change
Wild-type0.2 mM50-70%5-8 fold increaseModerate increase
FtsH-depleted0 mM90-95%1.5-2 fold increaseDetectable increase
FtsH-depleted0.1 mM40-60%8-10 fold increaseSignificant accumulation
FtsH-depleted0.2 mM10-30%10-15 fold increaseMajor accumulation

This approach, similar to studies on wheat FtsH responses to metal stress , would provide insights into how H. chejuensis FtsH contributes to stress adaptation mechanisms specific to its marine environment.

How might recombinant H. chejuensis FtsH interact with the prodigiosin biosynthesis pathway?

Investigating potential interactions between recombinant H. chejuensis FtsH and the prodigiosin biosynthesis pathway represents an intriguing research direction, given the significance of prodigiosin in H. chejuensis biology . Methodological approaches should include:

  • Proteolytic regulation analysis:

    • Identify whether FtsH directly degrades any proteins encoded by the hap gene cluster

    • Test if regulatory proteins like HapXY (two-component signal transduction system) are FtsH substrates

    • Determine if FtsH modulates the stability of transcription factors controlling hap gene expression

  • Gene expression studies:

    • Compare prodigiosin production in wild-type versus FtsH-depleted strains

    • Analyze transcription levels of hap genes in the presence/absence of functional FtsH

    • Monitor expression patterns of FtsH under conditions favoring prodigiosin production

  • Protein-protein interaction studies:

    • Co-immunoprecipitation assays with tagged FtsH and Hap proteins

    • Bacterial two-hybrid screening to identify potential interactions

    • Crosslinking mass spectrometry to detect transient interactions

  • Metabolic engineering approaches:

    • Construct strains with modified FtsH expression and monitor effects on prodigiosin yields

    • Test whether optimizing FtsH activity can enhance prodigiosin production

A systematic experimental design would involve creating several H. chejuensis strains with varying FtsH expression levels (wild-type, depleted, overexpressed) and measuring their prodigiosin production under different growth conditions. The experiment could be structured as follows:

StrainGrowth ConditionProdigiosin Productionhap Gene ExpressionHapXY Protein Levels
Wild-typeStandard mediaBaselineBaselineBaseline
Wild-typeInducing condition3-5 fold increase2-4 fold increase1.5-2 fold increase
FtsH-depletedStandard mediaVariableVariableVariable
FtsH-depletedInducing conditionVariableVariableVariable
FtsH-overexpressedStandard mediaVariableVariableVariable
FtsH-overexpressedInducing conditionVariableVariableVariable

This approach would reveal whether FtsH plays a regulatory role in prodigiosin biosynthesis, potentially through proteolytic control of key regulatory factors like the two-component system HapXY known to affect pigment production .

How can researchers address challenges in recombinant H. chejuensis FtsH expression and solubility?

Addressing challenges in recombinant H. chejuensis FtsH expression and solubility requires systematic troubleshooting strategies tailored to membrane-bound metalloproteases. The following methodological approaches are recommended:

  • Expression optimization:

    • Test multiple fusion tags (MBP, SUMO, Trx, GST) to improve solubility

    • Evaluate expression at lower temperatures (16-20°C) to enhance proper folding

    • Try auto-induction media instead of IPTG induction for gentler expression

    • Consider codon optimization based on the expression host's codon usage bias

  • Solubilization strategies:

    • Screen a comprehensive panel of detergents (DDM, LDAO, FC-12, LMNG)

    • Test detergent combinations and detergent:protein ratios

    • Explore novel solubilization agents like SMALPs (styrene-maleic acid lipid particles)

    • Incorporate stabilizing additives (glycerol, specific lipids, zinc)

  • Construct optimization:

    • Create truncated constructs that retain the catalytic domains but remove problematic regions

    • Design chimeric constructs with well-expressed homologs from related species

    • Introduce stabilizing mutations based on homology modeling

  • Alternative expression systems:

    • Consider cell-free expression systems optimized for membrane proteins

    • Evaluate expression in eukaryotic systems (insect cells, yeast)

    • Try specialized bacterial strains with modified membrane compositions

A systematic troubleshooting matrix would include:

IssueDiagnostic IndicationSolution StrategySuccess Indicator
Low expressionWeak band on western blotTest different promoters, strains, and induction conditions≥3-fold increase in expression
Inclusion body formationProtein in insoluble fractionLower temperature, co-express chaperones, use solubility tags≥50% protein in soluble fraction
Inactive proteinNo ATPase/protease activityOptimize buffer conditions, add stabilizing agentsRestored enzymatic activity
AggregationElution in void volume in SECScreen detergents, adjust salt concentrationMonodisperse peak at expected hexamer size

These approaches should be documented systematically, with careful record-keeping of all conditions tested to identify patterns that may inform successful expression and solubilization strategies.

How should researchers interpret contradictory results when characterizing recombinant H. chejuensis FtsH?

Interpreting contradictory results when characterizing recombinant H. chejuensis FtsH requires a methodical approach to distinguish between technical artifacts and genuine biological phenomena. Researchers should follow these systematic strategies:

  • Validation through methodological triangulation:

    • Verify findings using multiple orthogonal techniques

    • For contradictory activity measurements, test using different substrate types

    • Confirm structural assessments with complementary methods (CD spectroscopy, thermal shift assays, limited proteolysis)

  • Systematic error identification:

    • Evaluate reagent quality and preparation methods

    • Check for instrument calibration issues

    • Assess potential inhibitors or activators in buffer components

    • Consider post-translational modifications or proteolytic degradation

  • Biological variability assessment:

    • Determine if contradictions reflect natural heterogeneity

    • Consider allosteric regulation or conformational dynamics

    • Evaluate potential effects of oligomeric state differences

  • Reconciliation strategies:

    • Develop working models that explain apparent contradictions

    • Design critical experiments to differentiate between competing hypotheses

    • Compare with related FtsH proteins to identify conserved behaviors

When faced with specific contradictory results, researchers should construct a structured analysis table:

Contradictory ObservationTechnique 1Technique 2Potential ExplanationCritical Experiment
ATPase activityHigh activity (colorimetric)Low activity (radioactive)Buffer components affecting one assaySide-by-side comparison with controlled variables
Oligomeric stateHexamer (SEC)Monomer (Native PAGE)Detergent effect on oligomerizationTest multiple detergents at varying concentrations
Zinc dependencyEssential (EDTA inhibition)Non-essential (activity in EDTA)Secondary metal bindingICP-MS to quantify metal content

This methodological approach acknowledges that contradictions often reveal important biological insights about protein function and regulation. In particular, H. chejuensis FtsH may exhibit unique properties compared to better-characterized homologs due to adaptations to marine environments, potentially explaining some contradictory observations. Researchers should maintain detailed records of all experimental conditions to facilitate retrospective analysis when contradictions arise.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.