Recombinant Hahella chejuensis ATP synthase subunit a 1 (atpB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Hahella chejuensis and ATP Synthases

Hahella chejuensis is a gram-negative marine bacterium initially isolated from marine sediments near Cheju Island, Korea. This organism has attracted significant scientific attention due to its production of prodigiosin, a red pigment with algicidal, immunosuppressive, and anticancer activities . The bacterium also possesses unique genomic features, including two type III secretion systems (T3SSs) that share similarities with those found in animal pathogens .

ATP synthases (F-type ATPases) are remarkable molecular machines that function as rotary motors, synthesizing ATP from ADP and inorganic phosphate using the energy stored in transmembrane electrochemical gradients. These enzymes are widely distributed across all domains of life and are critical for cellular energy homeostasis . The F-type ATP synthase complex typically comprises two main structural components: a hydrophilic F₁ portion (α₃β₃γδε) that catalyzes ATP synthesis/hydrolysis, and a membrane-embedded F₀ portion (ab₂c₁₀) responsible for proton transport .

In the classical bacterial ATP synthase, eight different polypeptide subunits are arranged in a stoichiometry of α₃β₃γδεab₂c₁₀. These can be functionally divided into rotor subunits (γεc₁₀) and stator subunits (α₃β₃δab₂) . The subunit a, which includes atpB1 in H. chejuensis, plays a crucial role in proton translocation through the membrane as part of the F₀ portion of the complex.

Recombinant Expression and Purification

The successful production of recombinant H. chejuensis atpB1 has been accomplished using Escherichia coli as an expression host . The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography techniques .

Expression System

The recombinant protein is produced in E. coli expression systems, which offer several advantages for membrane protein production, including:

  • Well-established genetic manipulation protocols

  • Rapid growth and high protein yields

  • Compatible cellular machinery for bacterial protein expression

  • Scalable production procedures

Purification Method

The purification process for recombinant H. chejuensis atpB1 typically involves the following steps:

  1. Cell lysis to release cellular contents

  2. Membrane isolation by differential centrifugation

  3. Solubilization of membrane proteins using appropriate detergents

  4. Immobilized metal affinity chromatography (IMAC) using the His-tag

  5. Additional purification steps (e.g., size exclusion chromatography) if required

  6. Final formulation in an appropriate buffer system

The purified protein typically reaches a purity level greater than 90% as determined by SDS-PAGE analysis .

Physicochemical Properties

The recombinant H. chejuensis atpB1 protein exhibits several important physicochemical properties that are relevant to its handling, storage, and application in research settings.

Reconstitution Protocol

For lyophilized protein, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 50% for long-term storage

  4. Prepare working aliquots to avoid repeated freeze-thaw cycles

Applications and Research Significance

The recombinant H. chejuensis atpB1 protein serves as a valuable tool for various research applications focused on understanding bacterial bioenergetics, membrane protein structure-function relationships, and the development of potential biotechnological applications.

Antibody Production and Immunoassays

The purified recombinant protein can serve as an antigen for:

  • Production of polyclonal or monoclonal antibodies

  • Development of immunoassays to detect and quantify the protein in various samples

  • Immunolocalization studies to determine the subcellular distribution of the protein

Comparative Bioenergetics

The study of H. chejuensis atpB1 offers unique opportunities for comparative analysis with ATP synthases from other organisms, potentially revealing evolutionary adaptations to marine environments. While most research on A₁A₀ ATP synthases with V-type c subunits has focused on hyperthermophilic archaea, finding and characterizing similar systems in mesophilic organisms like H. chejuensis could enable bioenergetic analyses that are difficult at high temperatures .

Biotechnological Applications

Potential biotechnological applications include:

  • Development of biosensors for environmental monitoring

  • Design of novel inhibitors targeting bacterial ATP synthases

  • Creation of biomimetic energy-conversion systems inspired by natural ATP synthases

Future Research Directions

Research on H. chejuensis atpB1 is still in its early stages, with several promising directions for future investigation:

Structure-Function Relationships

Determining the high-resolution structure of H. chejuensis atpB1 and its integration within the complete ATP synthase complex would provide valuable insights into its precise mechanism of action. Recent advances in cryo-EM have enabled visualization of ATP synthases from other photosynthetic bacteria, revealing unexpected structural arrangements .

Regulatory Mechanisms

Investigating potential regulatory mechanisms affecting H. chejuensis ATP synthase activity could reveal adaptations specific to marine environments. Studies on other ATP synthases have identified regulatory factors such as the ATPase inhibitory factor 1 (IF1) that can modulate enzyme activity in response to physiological conditions .

Energy Coupling and Substrate Specificity

Exploring whether H. chejuensis ATP synthase exhibits unique coupling efficiency or substrate preferences compared to those from other organisms could provide insights into evolutionary adaptations. Recent research has identified interactions between proteins like AIFM1 and AK2 as gatekeepers of ATP synthase activity in other systems .

Evolutionary Significance

Comparative genomic and proteomic analyses could elucidate the evolutionary history of H. chejuensis atpB1 and its relationship to ATP synthase subunits in other organisms. The unique features of ATP synthases from marine bacteria may represent adaptations to specific environmental pressures.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order, and we will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB1; HCH_00920; ATP synthase subunit a 1; ATP synthase F0 sector subunit a 1; F-ATPase subunit 6 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
atpB1
Target Protein Sequence
MNDGVSTPVWLHIGPLEIHETVVTTWLIMLVLVVASILLTRRLSLQPGRLQAMLEGVVLT LESAIANADSRNARRLLPLIGTFWIFLPVANLLGVIPGMHSPTRDLSVTAALALVVFFAV HAYGVRQSGLGYFKHYLSPSPILLPFHIISEFTRTVALAIRLFGNIMSLEMAALLILLVA GFLAPVPILMLHIIEALVQAYIFGMLALIYVAGAMQQTTESPITSSSRSTSGAP
Uniprot No.

Target Background

Function
ATP synthase subunit a 1 (atpB1) is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does atpB1 function within the ATP synthase complex?

The atpB1 protein functions as a critical component of the F0 sector of ATP synthase, participating in the proton translocation mechanism that drives ATP synthesis. As subunit a, it forms part of the membrane-embedded proton channel, working in conjunction with the c-ring to facilitate proton movement across the membrane. This proton flow creates a rotational force that drives conformational changes in the F1 sector, enabling ATP synthesis.

The protein's highly hydrophobic regions form transmembrane helices that create the structural framework for proton movement. Key charged residues within these transmembrane regions are essential for establishing the proton pathway. The protein's positioning at the interface between the stationary and rotating parts of ATP synthase makes it crucial for energy conversion from the proton gradient to mechanical rotation.

What expression systems can be used for recombinant production of Hahella chejuensis atpB1?

The commercial recombinant form of Hahella chejuensis atpB1 is successfully expressed in E. coli with an N-terminal His tag . This bacterial expression system offers several advantages for membrane protein production, including:

  • High yield production suitable for biochemical and structural studies

  • Established protocols for induction and protein harvesting

  • Compatibility with various fusion tags for purification

  • Scalable production processes

Alternative expression systems that researchers might consider include:

  • Yeast systems (S. cerevisiae or P. pastoris) for eukaryotic post-translational processing

  • Cell-free expression systems for direct synthesis of potentially toxic membrane proteins

  • Insect cell expression for complex membrane proteins requiring specific folding conditions

Selection of an appropriate expression system should consider protein solubility, functionality, and downstream application requirements.

What are the optimal conditions for reconstituting lyophilized recombinant atpB1 protein?

For optimal reconstitution of lyophilized recombinant Hahella chejuensis atpB1 protein, follow these methodological steps:

  • Centrifuge the vial briefly before opening to ensure all product is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimal concentration is 50%) to enhance stability

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

For membrane protein reconstitution experiments, consider incorporating the protein into liposomes or nanodiscs to maintain its native conformation and functionality. This typically involves additional steps:

  • Preparation of lipid vesicles using lipids that mimic the native membrane environment

  • Solubilization of the reconstituted protein in detergent

  • Controlled removal of detergent to facilitate protein incorporation into lipid vesicles

  • Verification of successful reconstitution through functional assays

How can researchers verify the structural integrity of recombinant atpB1 after reconstitution?

Verifying structural integrity of reconstituted atpB1 requires a multi-faceted approach:

  • Circular Dichroism (CD) Spectroscopy: Analyze secondary structure content and compare with predicted structural elements. For atpB1, expect significant α-helical content characteristic of transmembrane domains.

  • Thermal Shift Assays: Assess protein stability under various buffer conditions by monitoring unfolding temperatures.

  • Limited Proteolysis: Compare digestion patterns of freshly reconstituted protein versus potentially misfolded samples to identify structural differences.

  • Size Exclusion Chromatography (SEC): Evaluate protein aggregation state and homogeneity.

  • Functional Assays: For atpB1, consider proton conductance assays using reconstituted proteoliposomes with pH-sensitive fluorescent dyes.

The most definitive approach combines complementary techniques to build a comprehensive picture of structural integrity.

How can atpB1 be incorporated into biocatalytic cascades similar to other fusion enzymes?

Drawing from research on other fusion enzymes like PtTamA and PtTamH , researchers can explore incorporation of atpB1 into biocatalytic cascades through several approaches:

  • Domain-based engineering: The success of other natural fusion enzymes suggests potential for engineering atpB1 into multi-domain constructs. For example, researchers might consider fusion with complementary domains that can utilize the energy from proton gradients for coupled reactions.

  • Catalyst immobilization strategies: Co-immobilize atpB1 with partner enzymes on solid supports or within membrane-mimetic environments to facilitate substrate channeling between catalytic sites.

  • Proteoliposome systems: Reconstitute atpB1 into liposomes containing additional enzymes to create compartmentalized reaction vessels with controlled internal conditions.

  • Synthetic biology approaches: Draw inspiration from the coupled PtTamA-PtTamH system that successfully converts fatty acids to amines . Similarly, atpB1 could potentially be coupled with enzymes that utilize ATP or proton gradients.

  • Microfluidic platforms: Design continuous-flow systems where atpB1-containing membranes are integrated with downstream enzymatic processes.

Success in these approaches would require careful consideration of the structural and functional characteristics of atpB1, particularly its membrane-embedded nature and role in proton translocation.

What methods are most effective for studying the interaction between atpB1 and other ATP synthase subunits?

To effectively study interactions between atpB1 and other ATP synthase subunits, researchers should employ a combination of complementary approaches:

  • Crosslinking-Mass Spectrometry (XL-MS): Use chemical crosslinkers with varying spacer lengths to capture transient interactions, followed by mass spectrometric analysis to identify interaction sites.

  • Förster Resonance Energy Transfer (FRET): Engineer fluorescent protein pairs at strategic positions in atpB1 and partner subunits to monitor real-time interactions in membrane environments.

  • Co-purification assays: Implement tandem affinity purification strategies with differentially tagged subunits to isolate stable subcomplexes containing atpB1.

  • Surface Plasmon Resonance (SPR): Immobilize atpB1 or partner subunits on sensor chips in the presence of appropriate detergents to measure binding kinetics.

  • Cryo-electron microscopy: For structural characterization of larger assemblies containing atpB1, particularly in membrane environments.

  • Computational modeling: Employ molecular dynamics simulations to predict interaction interfaces and validate experimental findings.

The choice of method should consider the highly hydrophobic nature of atpB1 and the need to maintain appropriate membrane-mimetic environments throughout the analysis.

How does Hahella chejuensis atpB1 compare structurally and functionally to homologous proteins in other organisms?

Hahella chejuensis atpB1 shares significant sequence homology with ATP synthase subunit a proteins from various bacterial species. Comparative analysis reveals:

  • Sequence conservation: Key functional regions, particularly transmembrane helices and residues involved in proton translocation, show higher conservation across species. For example, Hahella chejuensis atpB1 shows approximately 62% sequence identity with homologs from other bacterial species .

  • Structural predictions: Despite sequence variations, secondary structure predictions suggest conservation of the core transmembrane topology essential for function. Most bacterial ATP synthase a-subunits contain 5-6 transmembrane helices, with specific charged residues positioned for proton transfer.

  • Functional motifs: Critical functional motifs for proton channeling are likely conserved, though subtle variations may exist that affect efficiency or regulatory properties.

  • Regulatory elements: Differences in regulatory regions may reflect adaptation to specific environmental niches, such as the marine environment of Hahella chejuensis.

  • Evolutionary pressures: Conservation analysis suggests strong purifying selection on functional domains, consistent with the essential nature of ATP synthesis for cellular energy metabolism.

This comparative analysis provides context for interpreting experimental observations and may guide the design of mutational studies to explore structure-function relationships.

How can gene expression analysis inform our understanding of atpB1 regulation in different environmental conditions?

Gene expression analysis can provide valuable insights into atpB1 regulation through systematic approaches:

  • Differential expression analysis: Studies have shown that ATP synthase genes, including those from Hahella chejuensis, can be differentially regulated under various environmental conditions . For example, transcriptomic analysis can reveal how atpB1 expression changes in response to:

    • Oxygen availability

    • Nutrient limitation

    • Temperature shifts

    • pH changes

    • Osmotic stress

  • Regulatory network reconstruction: By correlating atpB1 expression patterns with other genes, researchers can identify potential regulatory factors. This approach has been successfully applied to identify global regulators like CpxR that affect metabolic pathways in other bacterial systems .

  • Promoter analysis: Examining the promoter region of atpB1 can reveal binding sites for transcription factors. Similar to studies on other metabolic enzymes, researchers might apply techniques like electrophoretic mobility shift assays (EMSA) to identify specific regulatory proteins .

  • Environmental adaptation studies: For marine bacteria like Hahella chejuensis, comparing expression patterns across different marine conditions can reveal adaptation mechanisms that maximize energy efficiency.

  • Comparative genomics: Analyzing the genomic context of atpB1 across related species can identify conserved regulatory elements that may control expression.

These approaches collectively can reveal the regulatory mechanisms that control atpB1 expression and its integration into cellular energy metabolism networks.

What are the common challenges in maintaining recombinant atpB1 stability and how can they be addressed?

Researchers working with recombinant atpB1 often encounter several stability challenges that can be addressed through specific methodological approaches:

  • Aggregation during storage:

    • Challenge: As a membrane protein, atpB1 has a tendency to aggregate when stored improperly.

    • Solution: Store in buffer containing 6% trehalose at pH 8.0 , and add glycerol to a final concentration of 50% for cryoprotection. Aliquot to minimize freeze-thaw cycles.

  • Denaturation during reconstitution:

    • Challenge: Improper reconstitution can lead to misfolding and loss of structural integrity.

    • Solution: Reconstitute gradually at 4°C with gentle mixing rather than vortexing. Consider adding stabilizing agents such as specific lipids that mimic the native membrane environment.

  • Oxidation of sensitive residues:

    • Challenge: Cysteine and methionine residues are susceptible to oxidation during storage and handling.

    • Solution: Include reducing agents like DTT or TCEP in storage buffers and work under nitrogen atmosphere when possible.

  • pH sensitivity:

    • Challenge: ATP synthase components often show pH-dependent stability profiles.

    • Solution: Carefully control pH during reconstitution and storage, typically maintaining pH 7.5-8.0 for optimal stability.

  • Temperature fluctuations:

    • Challenge: Repeated temperature changes can accelerate protein degradation.

    • Solution: Maintain stable temperature conditions during experiments and store long-term samples at consistent ultra-low temperatures (-80°C).

Implementing these methodological solutions can significantly improve recombinant atpB1 stability and experimental reproducibility.

What analytical methods are most appropriate for assessing the purity and integrity of recombinant atpB1 preparations?

For comprehensive quality assessment of recombinant atpB1 preparations, researchers should employ multiple complementary analytical methods:

  • SDS-PAGE analysis: The primary method for purity assessment, typically showing >90% purity for research-grade preparations . For membrane proteins like atpB1, modified protocols may be needed:

    • Use gradient gels (10-20%) for better resolution

    • Consider specialized staining methods for hydrophobic proteins

    • Include positive controls of known concentration for quantitative analysis

  • Western blotting: Using anti-His antibodies to confirm the presence of the N-terminal His tag on atpB1.

  • Mass spectrometry:

    • Intact mass analysis to confirm the expected molecular weight

    • Peptide mapping after proteolytic digestion to verify sequence coverage

    • Analysis of potential post-translational modifications or truncations

  • Size exclusion chromatography (SEC):

    • Assess homogeneity and aggregation state

    • Compare elution profiles to standards to estimate oligomeric state

  • Dynamic light scattering (DLS):

    • Measure particle size distribution to detect aggregation

    • Monitor stability over time under different storage conditions

  • Functional assays:

    • Proton translocation assays using reconstituted proteoliposomes

    • ATP hydrolysis assays when incorporated into the complete ATP synthase complex

These methods collectively provide a comprehensive assessment of both the physical and functional integrity of recombinant atpB1 preparations.

How might atpB1 be engineered for applications in synthetic biocatalytic systems?

Engineering atpB1 for synthetic biocatalytic applications presents exciting opportunities at the intersection of membrane protein science and biotechnology:

  • Domain fusion strategies: Taking inspiration from natural fusion enzymes like PtTamA and PtTamH , researchers could engineer atpB1 chimeras with complementary catalytic domains. This approach might create novel energy-transducing catalysts that couple proton translocation to chemical transformations.

  • Site-directed mutagenesis approaches:

    • Modify proton pathway residues to alter translocation efficiency

    • Engineer pH sensitivity to create environmentally responsive systems

    • Introduce non-canonical amino acids at key positions to enable novel functionalities

  • Integration with artificial membrane systems:

    • Incorporate engineered atpB1 into synthetic lipid bilayers or nanodiscs

    • Develop atpB1-polymer hybrid materials for stable artificial energy-harvesting systems

    • Create biohybrid interfaces between atpB1-containing membranes and electronic components

  • Modular assembly strategies:

    • Design atpB1 variants with orthogonal interaction interfaces

    • Enable controlled assembly with other ATP synthase components

    • Create programmable assembly systems with tunable stoichiometry

  • Computational design approaches:

    • Apply protein structure prediction and molecular dynamics to design stable variants

    • Utilize machine learning algorithms to predict functional consequences of mutations

    • Model energy coupling between atpB1 and engineered partner proteins

These approaches could lead to novel biocatalytic systems that harness the energy-transducing capabilities of atpB1 for applications in synthetic biology, bioenergy, and nanobiotechnology.

What are the prospects for structural determination of Hahella chejuensis atpB1 and how would this advance our understanding?

The structural determination of Hahella chejuensis atpB1 presents both significant challenges and opportunities for advancing our understanding of ATP synthase function:

  • Current structural knowledge gap: While structures exist for ATP synthase complexes from several organisms, high-resolution structures of the a-subunit from marine bacteria like Hahella chejuensis remain elusive. Obtaining such structures would illuminate adaptation mechanisms to marine environments.

  • Methodological approaches:

    • Cryo-electron microscopy (cryo-EM): Currently the most promising approach for membrane protein complexes, potentially enabling visualization of atpB1 in different conformational states

    • X-ray crystallography: Challenging for isolated atpB1 but possible for stabilized constructs with fusion partners

    • NMR spectroscopy: Suitable for specific domains or with advanced techniques like solid-state NMR

  • Expected scientific insights:

    • Detailed proton translocation pathway specific to Hahella chejuensis

    • Structural basis for adaptation to marine environments

    • Conformational changes associated with ATP synthesis

    • Interface details with other subunits of the ATP synthase complex

  • Technical challenges to overcome:

    • Protein stability during purification and analysis

    • Obtaining homogeneous preparations suitable for structural studies

    • Capturing physiologically relevant conformational states

  • Integrative structural biology approaches:

    • Combine multiple structural techniques with computational modeling

    • Validate structural models with functional assays

    • Use crosslinking mass spectrometry to identify interaction interfaces

Successful structural determination would significantly advance our understanding of energy conversion mechanisms in ATP synthases and potentially inform the design of novel bioenergetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.