Recombinant Hahella chejuensis Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Hahella chejuensis Disulfide Bond Formation Protein B (DsbB) is a genetically engineered version of the native DsbB enzyme, produced in Escherichia coli for research applications. DsbB is an inner membrane redox enzyme critical for oxidative protein folding in bacterial periplasmic spaces. It catalyzes the reoxidation of DsbA, a thiol-disulfide oxidoreductase, enabling the formation of structural disulfide bonds in secreted proteins .

Key Functions:

  • Transmembrane electron transfer via ubiquinone/menaquinone .

  • Maintenance of redox homeostasis in the periplasm .

  • Essential for virulence in pathogenic bacteria due to its role in stabilizing secreted toxins and adhesins .

Protein Architecture

The Hahella chejuensis DsbB (UniProt ID: Q2S8G1) shares conserved structural motifs with homologs like E. coli DsbB:

  • Four transmembrane α-helices forming a quinone-binding pocket .

  • Two periplasmic loops containing catalytic cysteine pairs:

    • Cys41–Cys44 (quinone-interacting site).

    • Cys104–Cys130 (DsbA-binding site) .

Sequence Analysis
The recombinant protein (1–165 aa) includes:

  • A conserved Cys-x-x-Cys motif critical for disulfide exchange .

  • Predicted molecular weight: ~19 kDa (calculated from sequence data) .

Biochemical Properties

PropertyDetails
Expression HostEscherichia coli
TagDetermined during production (commonly His-tag for purification) .
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol
ReconstitutionDeionized sterile water; avoid repeated freeze-thaw cycles .

Oxidative Folding Studies

  • Used to investigate disulfide bond formation mechanisms in γ-proteobacteria .

  • Enables in vitro reconstitution of redox pathways with DsbA and quinones .

Industrial Biotechnology

  • Facilitates high-yield production of disulfide-bonded recombinant proteins (e.g., antibodies, enzymes) in E. coli .

  • Critical for optimizing CyDisCo (Cytoplasmic Disulfide Bond Formation in E. coli) systems .

Comparative Analysis with Other DsbB Homologs

FeatureHahella chejuensis DsbBE. coli DsbBBacillus subtilis BdbC
UniProt IDQ2S8G1P0A6M2O32217
Transmembrane Helices444
Catalytic CysteinesCys41, Cys44, Cys104, Cys130Cys41, Cys44, Cys104, Cys130Cys46, Cys49, Cys112, Cys138
Quinone InteractionUbiquinoneUbiquinone/MenaquinoneMenaquinone
Expression Yield~0.1–1.0 mg/mL 5–450 mg/L Not reported

Mechanistic Insights

  • Electron Transfer Pathway: Electrons flow from substrate proteins → DsbA → DsbB → quinone, driven by redox potential gradients .

  • Conformational Flexibility: The Cys104–Cys130 loop exhibits structural mobility, enabling dynamic interactions with DsbA .

Industrial Relevance

  • Co-expression with DsbA and DsbD enhances yields of complex proteins (e.g., horseradish peroxidase, nerve growth factor) .

  • Engineered E. coli strains (e.g., SHuffle) utilizing DsbB homologs show improved folding of eukaryotic proteins .

Future Directions

  • Structural Studies: Cryo-EM analysis of Hahella chejuensis DsbB-quinone complexes to resolve electron transfer mechanisms .

  • Biotechnological Optimization: Leveraging DsbB’s redox properties for synthetic biology applications, including biofuel enzyme production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will then fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it for you.
Synonyms
dsbB; HCH_06418; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
dsbB
Target Protein Sequence
MPAWLTNRTIYFLCFLAIAGLMGFAFYLQYVKDLEPCPLCMAQRIAFVLAGLVFLAAALH NPKNTGTTVYAFLGWVTTLGGAALATRQLWLQSLPADQVPACGPGLEYMLEAFPFSEVLT MMLTGTGECAEVQWTFLGLSIPGWTLVAFIGFTAVWAFAWVRRPR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of dsbB in bacterial systems like Hahella chejuensis?

Disulfide bond formation protein B (dsbB) plays a critical role in the oxidative protein folding pathway in bacteria. While not specifically mentioned in the current literature for H. chejuensis, dsbB typically functions as a membrane protein that reoxidizes DsbA, maintaining the electron transport chain necessary for proper disulfide bond formation in the periplasm. In marine bacteria like H. chejuensis that produce bioactive compounds, proper protein folding is essential for the functionality of secreted enzymes and structural proteins.

The importance of proper protein folding pathways in H. chejuensis can be inferred from studies showing that this organism requires sophisticated regulatory systems for producing compounds like prodigiosin. For instance, research has identified that two-component signal transduction systems are involved in regulating pigment production in H. chejuensis . These complex regulatory networks likely depend on properly folded proteins, suggesting a potential role for dsbB in maintaining protein functionality within these pathways.

How does the genetic context of dsbB in Hahella chejuensis compare to other bacterial species?

While specific information about the dsbB gene in H. chejuensis is not detailed in the available literature, genomic analysis of this organism has revealed sophisticated gene clusters like the hap cluster responsible for prodigiosin biosynthesis . The complete genome sequencing of H. chejuensis provides a foundation for comparative genomic analysis of key cellular pathways.

Based on studies of related bacteria, we would expect dsbB to be part of a conserved disulfide bond formation pathway. In many bacteria, dsbB genes are often located in genomic regions associated with oxidative protein folding and membrane protein functions. Comparative genomic analysis would be necessary to determine whether dsbB in H. chejuensis is part of a specialized operon or gene neighborhood that might suggest unique functional adaptations to the marine environment.

What expression conditions influence dsbB production in Hahella chejuensis?

The expression of dsbB in H. chejuensis would likely be influenced by environmental factors that affect protein folding requirements, such as oxidative stress, salt concentration, and growth phase. The available research on H. chejuensis demonstrates that gene expression in this organism is highly regulated and responsive to environmental conditions.

Studies on prodigiosin biosynthesis in H. chejuensis have shown that the expression of the hap gene cluster is tightly controlled and dependent on specific regulatory cues . Similarly, expression of T3SS genes in H. chejuensis varies at different growth stages, as indicated by quantitative reverse transcription PCR analysis . This suggests that dsbB expression might also be growth-phase dependent and potentially correlated with the expression of secreted proteins requiring disulfide bonds for proper folding.

How might dsbB function relate to prodigiosin biosynthesis in Hahella chejuensis?

The biosynthesis of prodigiosin in H. chejuensis involves a complex pathway encoded by the hap gene cluster . While there is no direct evidence linking dsbB to prodigiosin biosynthesis in the available literature, a mechanistic connection can be hypothesized based on protein folding requirements.

The enzymatic components of the prodigiosin biosynthetic pathway likely require proper folding and potentially disulfide bond formation for optimal activity. Research has shown that heterologous expression of the hap cluster alone failed to produce pigment in E. coli, indicating that additional regulatory factors are required . One possibility is that proper protein folding infrastructure, potentially including dsbB function, may be necessary for the correct assembly and function of the prodigiosin biosynthetic machinery.

A methodological approach to investigate this connection would involve:

  • Generating dsbB knockout mutants in H. chejuensis

  • Assessing changes in prodigiosin production

  • Complementation studies with recombinant dsbB

  • Proteomic analysis of disulfide bond formation in hap cluster enzymes

What challenges exist in expressing recombinant Hahella chejuensis dsbB in heterologous systems?

Expressing membrane proteins like dsbB from marine bacteria presents several technical challenges. Based on experiences with heterologous expression of other H. chejuensis proteins, researchers should anticipate the following issues:

  • Codon optimization requirements: H. chejuensis has a distinct codon usage pattern that may not be optimal for expression in common laboratory hosts like E. coli.

  • Membrane integration difficulties: As a marine bacterium adapted to high salt environments, H. chejuensis membrane proteins may require specific lipid compositions or chaperones for proper folding and integration.

  • Functional assessment complexity: Studies on the heterologous expression of the hap cluster from H. chejuensis demonstrated that additional regulatory factors were required for functionality . Similarly, recombinant dsbB may require specific partner proteins or environmental conditions to maintain native activity.

  • Salt dependence: H. chejuensis is cultured in media containing 3% NaCl , suggesting that its proteins may have evolved structural adaptations to high salt environments that affect folding and stability when expressed in standard laboratory conditions.

What role might dsbB play in Type III Secretion System functionality in Hahella chejuensis?

H. chejuensis contains two T3SSs that are similar to those found in animal pathogens . The functionality of T3SS depends on the correct assembly of numerous protein components, many of which require proper folding and potentially disulfide bond formation.

The T3SS in H. chejuensis has been shown to elicit hypersensitive response (HR)-like cell death in the land plant Nicotiana benthamiana . This biological activity depends on properly folded effector proteins that are secreted through the T3SS machinery. The disulfide bond formation pathway, including dsbB, could be critical for maintaining the functionality of these secreted effectors.

Research approaches to investigate this connection could include:

  • Correlation analysis between dsbB expression and T3SS gene expression under different growth conditions

  • Assessment of T3SS functionality in dsbB mutant strains

  • Structural analysis of T3SS components for disulfide bond requirements

  • Comparative analysis with other bacterial T3SS that have known dependencies on disulfide bond formation

What expression systems are most suitable for producing functional recombinant Hahella chejuensis dsbB?

Based on previous work with H. chejuensis proteins, the following expression systems should be considered:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli (BL21)Rapid growth, high yieldMay not provide proper folding environmentCodon optimization, low temperature induction, membrane-targeting fusion tags
E. coli C41/C43Specialized for membrane proteinsLower yields than standard strainsOptimization of induction conditions, supplementation with H. chejuensis lipid extracts
Marine bacterial hostsNative-like membrane environmentLess developed genetic toolsDevelopment of shuttle vectors, optimization of transformation protocols
Cell-free systemsControl over reaction conditionsHigher cost, lower scalabilitySupplementation with specific lipids, controlled oxidation conditions

Research with other H. chejuensis proteins has shown that heterologous expression can be challenging. For instance, the hap cluster required additional regulatory factors from H. chejuensis for functional expression in E. coli . Therefore, co-expression with potential partner proteins or supplementation with H. chejuensis cell extracts might be necessary for obtaining functionally active recombinant dsbB.

What purification strategies are most effective for recombinant Hahella chejuensis dsbB?

Purification of recombinant dsbB from H. chejuensis would require specialized approaches for membrane proteins:

  • Detergent screening: A systematic evaluation of detergents for solubilization while maintaining protein structure and function. Common detergents for membrane protein purification include DDM, LDAO, and Triton X-100.

  • Affinity purification optimization: Placement of affinity tags (His, FLAG, etc.) should be carefully considered to avoid interference with membrane topology and function. Both N- and C-terminal tag constructs should be tested.

  • Salt concentration requirements: Given that H. chejuensis grows in 3% NaCl media , purification buffers may need to maintain higher salt concentrations than typically used for mesophilic bacteria.

  • Functional assessment during purification: Activity assays measuring dsbB-mediated electron transfer should be integrated into the purification workflow to ensure that functional protein is being isolated.

How can researchers establish a reliable activity assay for recombinant Hahella chejuensis dsbB?

A functional assay for dsbB activity typically measures its ability to reoxidize DsbA. For H. chejuensis dsbB, the following approach could be developed:

  • Coupled assay with DsbA: Using either native H. chejuensis DsbA (if available) or a well-characterized DsbA from another organism, monitor the electron transfer reaction.

  • Ubiquinone interaction assessment: DsbB transfers electrons to the respiratory chain via ubiquinone. Spectroscopic methods can be used to monitor this interaction.

  • Complementation assays: Testing the ability of H. chejuensis dsbB to complement dsbB-deficient E. coli strains, with readouts including motility, biofilm formation, or resistance to reducing agents.

  • Protein folding restoration: Measuring the restoration of activity for model proteins that require disulfide bonds for function in dsbB-deficient bacteria complemented with H. chejuensis dsbB.

What structural features distinguish Hahella chejuensis dsbB from homologs in other bacteria?

While specific structural information about H. chejuensis dsbB is not available in the current literature, comparative structural analysis would focus on:

  • Adaptation to marine environment: Structural features that might confer stability in high salt conditions, potentially including altered surface charge distribution, increased hydrophobicity, or specialized salt bridges.

  • Membrane topology prediction: Analysis of transmembrane domains and periplasmic loops that might differ from well-characterized dsbB proteins from E. coli and other model organisms.

  • Active site conservation: Assessment of the conservation of catalytic residues involved in disulfide exchange reactions, particularly the CXXC motifs essential for function.

  • Interaction surfaces: Potential adaptations in protein-protein interaction surfaces that might reflect co-evolution with partner proteins specific to H. chejuensis.

How can molecular dynamics simulations help understand dsbB function in Hahella chejuensis?

Molecular dynamics simulations could provide valuable insights into H. chejuensis dsbB by:

  • Modeling membrane integration: Simulating the protein within a lipid bilayer that mimics the composition of H. chejuensis membranes.

  • Salt adaptation mechanisms: Investigating structural stability and conformational changes under varying salt concentrations to understand marine adaptations.

  • Electron transfer pathways: Mapping the potential electron flow from DsbA through dsbB to ubiquinone, identifying any unique features in the H. chejuensis protein.

  • Protein-protein interaction prediction: Simulating interactions with potential partner proteins, including DsbA and components of the respiratory chain.

How might CRISPR-Cas9 techniques be applied to study dsbB function in Hahella chejuensis?

CRISPR-Cas9 genome editing could revolutionize functional studies of dsbB in H. chejuensis by enabling:

  • Precise gene knockout: Creating clean deletions of dsbB to assess its role in various cellular processes, including prodigiosin biosynthesis and T3SS functionality.

  • Domain swapping experiments: Replacing portions of H. chejuensis dsbB with homologous regions from other bacteria to identify functionally important regions.

  • Promoter modifications: Altering the native regulation of dsbB to understand its expression patterns and regulatory networks.

  • Tagged protein generation: Introducing epitope or fluorescent tags at the genomic level for tracking dsbB localization and interactions within native H. chejuensis cells.

Development of CRISPR-Cas9 systems for H. chejuensis would build upon existing genetic manipulation techniques demonstrated in the literature, such as the transformation methods used to introduce plasmids into this bacterium .

What implications does dsbB function have for biotechnological applications of Hahella chejuensis?

Understanding dsbB function in H. chejuensis could enhance several biotechnological applications:

  • Optimized prodigiosin production: If dsbB proves important for prodigiosin biosynthesis, its manipulation could enhance production of this valuable compound, which has shown promise as an immunosuppressant, anticancer agent, and algicide effective at concentrations as low as 1 ppb against harmful algal bloom-causing organisms .

  • Enhanced heterologous expression: Knowledge of H. chejuensis protein folding pathways could improve expression of its proteins in heterologous hosts, addressing challenges observed with the hap cluster expression .

  • Marine enzyme production: Insights into disulfide bond formation in this halophilic bacterium could facilitate the production of other marine enzymes with industrial potential.

  • Biocontrol applications: Understanding the molecular mechanisms behind H. chejuensis's interaction with harmful algae could lead to improved biocontrol strategies for harmful algal blooms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.