Recombinant Hahella chejuensis Electron transport complex protein RnfD (rnfD)

Shipped with Ice Packs
In Stock

Description

Introduction to Hahella chejuensis

Hahella chejuensis is a Gram-negative marine bacterium that was initially isolated from the coastal area of Marado in South Korea. This organism has gained significant scientific attention due to its lytic activity against Cochlodinium polykrikoides, a microalga responsible for harmful algal blooms (HABs) in Northeast Pacific coastal areas . The algicidal function of H. chejuensis stems from its production of prodigiosin, a red pigment with potential applications as an anticancer agent and immunosuppressant .

Genomic analysis reveals that H. chejuensis possesses a versatile metabolic profile well-adapted to its marine lifestyle. The bacterium contains a complete set of enzymes necessary for central carbon metabolism, including glycolysis, the pentose phosphate pathway, and the TCA cycle, as well as those required for the biosynthesis of nucleotides and all 20 amino acids . These capabilities support its free-living, heterotrophic lifestyle in marine environments. Additionally, H. chejuensis requires 2% NaCl for optimal growth, a characteristic trait of marine bacteria that utilize transmembrane Na+ gradients for nutrient uptake and flagellar rotation .

General Overview of Rnf Complexes

The Rnf (Rhodobacter nitrogen fixation) complex represents a membrane-bound electron transport system that has been identified in various microorganisms. This complex functions as an ion-motive electron transport chain that energetically couples cellular ferredoxin to the pyridine nucleotide pool . The Rnf complex shows similarities to the Na+-translocating NADH:ubiquinone oxidoreductase (Nqr) system .

In the broader context of microbial bioenergetics, Rnf complexes occupy an important niche by operating in the redox range more negative than -320 mV, which has been historically less studied compared to other electron transport chains . These complexes provide microorganisms with additional flexibility in their energy conservation strategies, particularly under varying environmental conditions.

Role in Marine Bacterial Metabolism

In marine bacteria like H. chejuensis, respiratory complexes including Rnf play crucial roles in maintaining sodium motive force. Genome analysis has identified respiratory complexes in H. chejuensis similar to the Na+-translocating respiratory NADH:ubiquinone oxidoreductase, which is widely distributed among Gram-negative marine bacteria . These complexes, along with multiple Na+/H+ antiporters, enable H. chejuensis to thrive in saline environments by maintaining appropriate ion gradients across the cell membrane.

Functional Domains

As a component of the Rnf complex, RnfD is likely involved in the coupling of electron transfer to ion translocation across the membrane. Based on studies of Rnf complexes in other organisms, RnfD probably contributes to the generation of electrochemical gradients that can be utilized for energy conservation within H. chejuensis .

While specific functional domains have not been fully characterized in the H. chejuensis RnfD protein based on the available search results, comparative analysis with homologous proteins in other bacteria suggests it may contain cofactor binding sites and ion channel-forming regions essential for its electron transport function.

Expression Systems

Recombinant H. chejuensis RnfD protein has been successfully expressed in Escherichia coli expression systems . The recombinant protein consists of the full-length sequence (amino acids 1-346) fused to an N-terminal His-tag to facilitate purification and detection . This expression approach provides a valuable tool for studying the protein's properties in isolation from its native complex.

Biotechnological Potential

Understanding the properties and function of RnfD may have biotechnological applications. The electron transport capabilities of Rnf complexes could potentially be harnessed for bioenergy applications or synthetic biology approaches. Additionally, as H. chejuensis produces compounds with algicidal activity and pharmaceutical potential, better understanding of its metabolic pathways, including electron transport systems, may facilitate the optimization of these bioactive compound production processes.

Marine Microbial Ecology

Research on H. chejuensis RnfD contributes to our broader understanding of how marine bacteria adapt to their environments. The sodium-dependent respiratory systems, including the Rnf complex, represent important adaptations to marine conditions . Insights into these systems enhance our knowledge of marine microbial ecology and the biochemical strategies employed by microorganisms in saline environments.

Functional Characterization

Additional biochemical and biophysical studies are needed to elucidate the precise function of RnfD within the Rnf complex of H. chejuensis. These could include electron transport assays, ion translocation measurements, and mutational studies to identify key residues involved in protein function.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us. We will prioritize the development of your specified tag type.
Synonyms
rnfD; HCH_01891; Ion-translocating oxidoreductase complex subunit D; Rnf electron transport complex subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-346
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
rnfD
Target Protein Sequence
MAFLRITSPHLKGPARTTAIMQWVILATVPGLLTMTWFFGWGTLINVVLASLTAVAAEAF VLTLRKRPLAFYLRDYSAVLTGVLLGLALPPYAPWWVTFVGTAFAIIFAKQIYGGLGNNP FNPAMVGYALLLVSFPVAMTTNWATPRPLAEIPGFLEAFARIFWNADIGVDGYTMATPLD TYKHEIVAGTAETVFALPVFGARTALGWEWVNLAFLAGGLLLIWRKIITWHIPVSMLAAL ALCSLLLGWDEDKYAPLQLHLLAGATMLGAFFIATDPVSAATSKLGKLYYGAGVGILTYL IRTWGNYPDAVAFAVLLMNFAAPFLDYYTQPRTYGHRKARRGVKQD
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane.
Database Links
Protein Families
NqrB/RnfD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Hahella chejuensis and why is it significant in microbial research?

Hahella chejuensis is a Gram-negative, aerobic, rod-shaped and motile marine bacterium isolated from sediment collected from Marado, Cheju Island, Republic of Korea. Its significance stems from its ability to produce abundant extracellular polysaccharides and a distinctive red pigment called prodigiosin . This bacterium has attracted considerable scientific attention due to its lytic activity against red-tide dinoflagellates, particularly Cochlodinium polykrikoides, a major microalga causing harmful algal blooms in the Northeast Pacific coastal area . H. chejuensis requires NaCl for growth (optimal at 2% concentration) and possesses oxidase and catalase activity . Phylogenetically, it forms a distinct line within the gamma Proteobacteria, with no valid bacterial species showing more than 90% sequence homology, warranting its classification as a new genus .

What is the Rnf complex and what role does RnfD play within this complex?

The Rnf complex is a membrane-bound, ion-motive electron transport chain that energetically couples cellular ferredoxin to the pyridine nucleotide pool . It functions as a ferredoxin:NAD+ oxidoreductase that catalyzes electron flow from ferredoxin to NAD+ coupled with electrogenic sodium ion (Na+) translocation across the membrane . The Rnf complex shares similarities with the Na+-translocating NADH:ubiquinone oxidoreductase (Nqr) system .

While the specific function of RnfD in H. chejuensis is not explicitly detailed in the available literature, it likely serves as one of the membrane-embedded subunits of the Rnf complex, contributing to the ion translocation machinery. Based on studies of Rnf complexes in other bacteria, RnfD would be part of a multi-subunit complex (typically including RnfA, RnfB, RnfC, RnfD, RnfE, and RnfG) that collectively facilitates this unique bioenergetic process operating in the redox range more negative than -320 mV .

How does the Rnf complex contribute to bacterial bioenergetics?

The Rnf complex represents a novel bioenergetic mechanism that operates in a redox range (more negative than -320 mV) that has been largely unexplored in bioenergetic studies . In bacteria like Acetobacterium woodii, the Rnf complex couples electron transfer from reduced ferredoxin to NAD+ with the electrogenic translocation of sodium ions (Na+) . This process:

  • Establishes an electrochemical Na+ gradient across the membrane that can drive ATP synthesis

  • Links the cellular ferredoxin pool to the pyridine nucleotide pool, enabling metabolic flexibility

  • Provides an alternative to the more common proton-motive force in bioenergetics

  • Creates a mechanism for energy conservation during anaerobic metabolism

Experimental evidence shows that this electron transport is inhibited by compounds such as AgNO₃, CuSO₄, 1,10-phenanthroline, and diphenyliodonium chloride, which simultaneously abolish Na+ transport, confirming the coupled nature of these processes .

What strategies should be employed when designing experiments to characterize recombinant H. chejuensis RnfD?

When designing experiments to characterize recombinant H. chejuensis RnfD, researchers should implement a systematic approach based on established principles of experimental design (DOE) :

  • Variable identification:

    • Independent variables: Expression conditions, purification methods, buffer compositions

    • Dependent variables: Protein yield, purity, activity, stability

    • Control variables: Temperature, pH, salt concentration

  • Statistical optimization:

    • Use factorial or response surface methodology designs to efficiently explore parameter space

    • Implement proper randomization and replication to ensure statistical validity

    • Include positive and negative controls in all experimental setups

  • Marine environment considerations:

    • Account for H. chejuensis's requirement for NaCl (optimally 2%) in all buffer systems

    • Consider the native membrane environment when designing solubilization strategies

  • Functional validation approaches:

    • Develop assays that specifically measure ferredoxin:NAD+ oxidoreductase activity

    • Establish methods to assess Na+ transport capability in reconstituted systems

    • Test sensitivity to known Rnf complex inhibitors (AgNO₃, CuSO₄, etc.)

The experimental design should balance comprehensiveness with resource efficiency, focusing on the most informative combinations of experimental conditions rather than testing all possible variations independently .

How can researchers effectively express and purify recombinant RnfD while maintaining its structural integrity?

Effective expression and purification of recombinant RnfD from H. chejuensis requires specialized approaches for membrane proteins:

Expression strategies:

  • Select appropriate expression systems (E. coli strains optimized for membrane proteins)

  • Design constructs with affinity tags positioned to avoid interference with membrane insertion

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Consider supplementing growth media with NaCl to mimic the native marine environment

Purification methodology:

  • Carefully select detergents for membrane solubilization (test a panel of mild non-ionic detergents)

  • Implement a multi-step purification process:

    • Initial capture via affinity chromatography

    • Further purification via ion exchange and size exclusion chromatography

  • Maintain appropriate salt concentration throughout purification

  • Include stabilizing agents to prevent protein denaturation

Structural integrity validation:

  • Assess secondary structure via circular dichroism spectroscopy

  • Verify oligomeric state through analytical ultracentrifugation

  • Monitor protein stability using differential scanning fluorimetry

  • Confirm proper folding through activity assays

Table 1: Recommended detergents for RnfD solubilization and purification

DetergentCMC (mM)AdvantagesLimitationsRecommended Use
n-Dodecyl-β-D-maltoside0.17Mild, maintains activityRelatively expensiveInitial extraction
Digitonin0.5Very mild, preserves protein-protein interactionsHigh cost, plant-derived variabilityComplex integrity studies
LMNG0.01High stability, low CMCHigh costLong-term stability
CHAPS8-10Compatible with many functional assaysLess efficient extractionFunctional studies

What controls and validation steps are essential when studying the electron transport function of recombinant RnfD?

When studying electron transport function of recombinant RnfD, implement these essential controls and validation steps:

Negative controls:

  • Prepare membrane vesicles/proteoliposomes without RnfD incorporation

  • Test electron transport in the presence of specific inhibitors (AgNO₃, CuSO₄, 1,10-phenanthroline)

  • Use denatured protein preparations as baseline references

Positive controls:

  • Include well-characterized electron transport proteins with known activity

  • If available, use native Rnf complex isolated from H. chejuensis

  • Test activity with established electron donors/acceptors for similar complexes

Functional validation:

  • Verify ferredoxin:NAD+ oxidoreductase activity spectrophotometrically

  • Confirm Na+ transport using radioactive ²²Na+ transport assays in vesicles

  • Assess directionality of electron flow and ion transport

  • Measure electrogenic nature of transport using voltage-sensitive dyes

Additional validation approaches:

  • Confirm that observed inhibition patterns match those reported for Rnf complexes

  • Verify that electron transport is coupled to Na+ translocation by demonstrating that ionophores (ETH2120) prevent Na+ accumulation

  • Conduct reconstitution experiments combining RnfD with other Rnf subunits to restore complete complex activity

How might the RnfD component be involved in the biosynthesis of prodigiosin in H. chejuensis?

The involvement of the RnfD component in prodigiosin biosynthesis in H. chejuensis represents an intriguing research question at the intersection of bioenergetics and secondary metabolism:

  • Energetic coupling hypothesis:
    The Rnf complex, including RnfD, may provide the energetic input required for prodigiosin biosynthesis through its role in establishing electrochemical Na+ gradients. This energy could power transporters or enzymes involved in the prodigiosin biosynthetic pathway (hap gene cluster) .

  • Redox regulation connection:
    The Rnf complex couples the cellular ferredoxin pool to NAD+ , potentially influencing the redox state of the cell. Prodigiosin biosynthesis involves redox-sensitive steps that might be regulated by the NAD+/NADH ratio maintained in part by Rnf activity.

  • Regulatory integration:
    Research on H. chejuensis has identified two-component signal transduction systems (TCS) as positive regulators of pigment production . The Rnf complex could interact with or influence these regulatory systems, as TCS are known to respond to environmental and metabolic signals.

  • Na+ homeostasis effects:
    As a Na+-translocating complex , Rnf might contribute to maintaining appropriate intracellular Na+ levels necessary for optimal activity of enzymes in the prodigiosin biosynthetic pathway.

Future research could employ RnfD mutants or inhibitors of the Rnf complex to directly assess its impact on prodigiosin production, potentially revealing new insights into the integration of primary metabolism (energy conservation) with secondary metabolism (prodigiosin production) in this marine bacterium.

What experimental approaches would be most effective for studying the role of RnfD in Na+ translocation?

Investigating the role of RnfD in Na+ translocation requires specialized experimental approaches:

1. Inverted membrane vesicle studies:

  • Prepare inverted membrane vesicles containing recombinant RnfD

  • Measure ²²Na+ transport into vesicles during ferredoxin-dependent NAD+ reduction

  • Test the electrogenic nature of transport using ionophores like ETH2120

  • Compare transport rates with and without specific inhibitors

2. Proteoliposome reconstitution:

  • Reconstitute purified RnfD into liposomes with defined lipid composition

  • Establish Na+ gradients and measure dissipation rates

  • Determine whether RnfD alone can facilitate Na+ transport or requires other Rnf subunits

  • Assess the directionality of transport relative to electron flow

3. Site-directed mutagenesis:

  • Identify conserved residues potentially involved in Na+ coordination

  • Create point mutations at these positions

  • Evaluate the impact on Na+ transport without disrupting protein folding

  • Map the Na+ translocation pathway through the protein

4. Electrophysiological approaches:

  • Utilize patch-clamp techniques on proteoliposomes containing RnfD

  • Measure Na+ currents under various conditions

  • Determine ion selectivity by testing different cations

  • Establish the voltage dependence of transport

5. Structural biology integration:

  • Correlate functional data with structural information

  • Use computational modeling to predict Na+ binding sites

  • Validate predictions through targeted mutations

  • Determine whether conformational changes accompany Na+ translocation

These approaches would provide complementary insights into the specific contribution of RnfD to the Na+ translocation mechanism of the Rnf complex.

How does the RnfD from H. chejuensis compare to homologous proteins in other marine bacteria?

Comparing RnfD from H. chejuensis to homologous proteins in other marine bacteria reveals important evolutionary and functional insights:

Sequence conservation and divergence:
The RnfD protein from H. chejuensis likely shares core functional domains with homologs from other bacteria while exhibiting adaptations specific to its marine environment. Key differences would be expected in:

  • Transmembrane domains that interact with the lipid bilayer

  • Residues involved in Na+ coordination

  • Interfaces with other Rnf subunits

Functional adaptations to marine environments:
Marine bacteria like H. chejuensis have adapted to high-salt environments, which is reflected in their protein characteristics:

  • Higher proportion of acidic residues on protein surfaces

  • Salt-dependent stability mechanisms

  • Specific ion selectivity features

Evolutionary relationships:
Phylogenetic analysis would likely position H. chejuensis RnfD within the gamma Proteobacteria clade, consistent with the bacterium's taxonomic classification . The uniqueness of H. chejuensis (less than 90% sequence homology with other valid bacterial species) suggests its RnfD may have distinctive features.

Table 2: Comparison of RnfD homologs across bacterial species

OrganismEnvironmentRnfD FeaturesIon SpecificityAssociated Metabolic Functions
Hahella chejuensisMarineAdapted to high saltNa+Possible link to prodigiosin production
Acetobacterium woodiiFreshwater anaerobicWell-characterizedNa+Acetogenesis
Marine gamma proteobacteriaMarineSalt-adaptedLikely Na+Various
Terrestrial bacteriaSoil/non-marineLess salt-adaptedVariable (Na+ or H+)Various

Comparative genomic approaches combined with structural modeling would help identify the specific adaptations of H. chejuensis RnfD that enable its function in the marine environment.

What analytical techniques are most suitable for studying the integration of RnfD into membrane systems?

Studying the integration of RnfD into membrane systems requires specialized analytical techniques:

Structural analysis techniques:

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structural information of membrane proteins in near-native environments

  • Atomic Force Microscopy (AFM): Reveals topography and organization of RnfD within membrane surfaces

  • Solid-state NMR: Offers atomic-level information about protein-lipid interactions in membrane environments

Functional integration assessment:

  • Fluorescence Recovery After Photobleaching (FRAP): Measures lateral mobility of labeled RnfD in membranes

  • Single-molecule tracking: Follows the movement and organization of individual RnfD molecules

  • Protease protection assays: Determines membrane topology by identifying protected regions

Membrane interaction studies:

  • Differential scanning calorimetry: Measures thermodynamic parameters of protein-lipid interactions

  • Monolayer insertion experiments: Quantifies protein insertion into lipid monolayers

  • Quartz Crystal Microbalance with Dissipation monitoring (QCM-D): Provides real-time analysis of protein binding to supported lipid bilayers

Computational approaches:

  • Molecular dynamics simulations: Models RnfD insertion and stability in membranes

  • Hydrophobicity analysis: Predicts membrane-spanning regions

  • Electrostatic surface mapping: Identifies regions likely to interact with membrane interfaces

These techniques should be applied with consideration of H. chejuensis's marine origin, potentially incorporating higher salt concentrations (optimally 2% NaCl) in experimental buffers to mimic the native environment.

How can researchers effectively design experiments to study the interaction between RnfD and other components of the Rnf complex?

Designing experiments to study RnfD interactions with other Rnf components requires multiple complementary approaches:

Protein-protein interaction methods:

  • Co-immunoprecipitation: Pull down RnfD and identify interacting partners

  • Crosslinking mass spectrometry: Map specific interaction sites between subunits

  • Surface plasmon resonance: Measure binding kinetics between purified components

  • Isothermal titration calorimetry: Determine thermodynamic parameters of binding

Genetic approaches:

  • Bacterial two-hybrid systems: Screen for interacting partners in vivo

  • Complementation studies: Express variants in knockout strains to assess functional interaction

  • Site-directed mutagenesis: Target predicted interface residues to disrupt specific interactions

Structural biology integration:

  • FRET (Förster Resonance Energy Transfer): Measure distances between labeled subunits

  • Native mass spectrometry: Analyze intact complexes and subcomplexes

  • Hydrogen-deuterium exchange: Identify protected regions upon complex formation

Experimental design considerations:

  • Apply statistical design of experiments (DOE) principles to efficiently explore interaction parameters

  • Include appropriate controls to distinguish specific from non-specific interactions

  • Validate results using multiple independent techniques

  • Consider the native membrane environment when designing in vitro experiments

Table 3: Experimental approaches for specific research questions about RnfD interactions

Research QuestionRecommended TechniquesKey ControlsExpected Outcome
Direct binding partnersCo-IP, crosslinkingNon-specific antibodies, Non-Rnf proteinsIdentification of direct RnfD interaction partners
Interface mappingHDX-MS, point mutationsConservative vs. disruptive mutationsSpecific residues/regions at subunit interfaces
Assembly sequenceTime-resolved native MSAssembly intermediatesOrder of subunit addition during complex formation
Functional couplingActivity assays with reconstituted subcomplexesIndividual subunits, incomplete complexesMinimal functional units within the complex

What approaches can be used to investigate the electron transfer mechanisms within the RnfD protein?

Investigating electron transfer mechanisms within RnfD requires specialized techniques that can detect and characterize redox processes:

Spectroscopic approaches:

  • UV-visible spectroscopy: Monitor changes in absorbance associated with cofactor redox state

  • Electron Paramagnetic Resonance (EPR): Detect and characterize paramagnetic centers

  • Resonance Raman spectroscopy: Analyze vibrational modes of redox-active cofactors

  • Mössbauer spectroscopy: Characterize iron-containing centers if present in RnfD

Electrochemical methods:

  • Protein film voltammetry: Determine redox potentials of cofactors

  • Mediated electrochemistry: Measure electron transfer rates

  • Spectroelectrochemistry: Combine spectroscopic and electrochemical measurements

Kinetic analysis:

  • Stopped-flow spectroscopy: Resolve rapid electron transfer events

  • Temperature dependence studies: Determine activation parameters

  • pH dependence analysis: Identify proton-coupled electron transfer

Structural approaches:

  • X-ray crystallography with multiple redox states: Capture structural changes

  • Distance measurements between redox centers: Using FRET or pulsed EPR

  • Computational modeling of electron tunneling pathways

When designing these experiments, researchers should consider:

  • The native membrane environment's influence on electron transfer

  • The potential requirement for other Rnf subunits to complete electron transfer pathways

  • The possible coupling between electron transfer and Na+ translocation

  • The integration of RnfD's function within the complete Rnf complex

These approaches would help elucidate whether RnfD contains redox cofactors itself or primarily facilitates electron transfer between other components of the Rnf complex.

How might structural determination of H. chejuensis RnfD advance our understanding of bacterial bioenergetics?

Structural determination of H. chejuensis RnfD would significantly advance bacterial bioenergetics in several ways:

  • Novel Na+ translocation mechanisms:

    • Reveal the molecular architecture of Na+ binding sites and translocation pathways

    • Identify structural features that determine ion selectivity (Na+ vs. H+)

    • Elucidate the coupling mechanism between electron transfer and ion movement

    • Compare with other Na+ transporters to identify convergent or divergent evolutionary solutions

  • Membrane protein adaptations to marine environments:

    • Identify structural features adapted to high-salt conditions

    • Reveal lipid-protein interfaces specialized for marine bacterial membranes

    • Understand stability mechanisms in halophilic membrane proteins

  • Electron transport chain organization:

    • Map the arrangement of potential cofactor binding sites

    • Identify electron transfer pathways through the protein structure

    • Understand how RnfD interfaces with other Rnf components

    • Reveal conformational changes that might occur during the catalytic cycle

  • Comparative structural biology insights:

    • Establish structural relationships with other ion-translocating complexes

    • Identify conserved structural elements across diverse bacterial species

    • Understand the structural basis for the redox range operating below -320 mV

These structural insights would fill a significant gap in our understanding of bacterial bioenergetics, particularly regarding membrane-bound electron transport systems operating in the largely unexplored redox range more negative than -320 mV .

What role might the study of RnfD play in developing biotechnological applications related to electron transport systems?

Studying RnfD from H. chejuensis could enable several innovative biotechnological applications:

1. Bioelectrochemical systems:

  • Development of bacterial biocatalysts for electricity generation

  • Creation of enzymes capable of directly transferring electrons to electrodes

  • Design of biosensors utilizing the electron transport capabilities of RnfD

2. Bioenergy applications:

  • Engineering of microorganisms with enhanced bioenergetic efficiency

  • Development of biological systems for hydrogen production

  • Creation of artificial photosynthetic systems incorporating RnfD components

3. Bioremediation technologies:

  • Design of bacteria with modified electron transport systems for contaminant reduction

  • Development of bioelectrochemical systems for wastewater treatment

  • Engineering of microbes capable of degrading recalcitrant compounds

4. Synthetic biology tools:

  • Creation of modular electron transport components for synthetic pathways

  • Development of redox sensors based on RnfD domains

  • Design of switchable electron transport systems for metabolic control

Table 4: Potential biotechnological applications based on RnfD research

Application AreaRnfD-Based TechnologyAdvantage Over Current ApproachesDevelopment Stage
Biofuel cellsNa+-coupled electron transfer systemsLower overpotential, alternative to proton-based systemsConceptual
BiosensorsRnfD-based redox detection systemsOperation in marine/high-salt environmentsEarly research
BioremediationEngineered electron transport pathwaysExpanded range of reducible contaminantsConceptual
Synthetic biologyModular electron transport componentsNovel redox coupling capabilitiesConceptual/early research

The unique properties of H. chejuensis as a marine bacterium with algicidal activity suggest that biotechnological applications developed from its RnfD protein might be particularly suitable for marine environments.

How might integration of genomic, transcriptomic, and proteomic approaches enhance our understanding of RnfD function in H. chejuensis?

Integration of multi-omics approaches would provide comprehensive insights into RnfD function:

Genomic approaches:

  • Comparative genomics across marine bacteria to identify conserved and variable regions in rnfD genes

  • Analysis of genomic context to understand co-evolution with other rnf genes

  • Identification of regulatory elements controlling rnfD expression

  • Evolutionary analysis to trace the origin and adaptation of rnfD in H. chejuensis

Transcriptomic approaches:

  • RNA-seq analysis under various growth conditions to identify factors regulating rnfD expression

  • Investigation of co-expression patterns with other genes (particularly the hap cluster involved in prodigiosin biosynthesis)

  • Identification of non-coding RNAs potentially regulating rnfD (similar to the Hfq-dependent non-coding region found in the hap cluster)

  • Analysis of transcriptional responses to environmental stresses

Proteomic approaches:

  • Quantitative proteomics to measure RnfD abundance under different conditions

  • Phosphoproteomics to identify potential regulatory modifications

  • Protein-protein interaction studies to map the RnfD interactome

  • Membrane proteomics to understand RnfD in its native context

Integrated analysis benefits:

  • Correlation of transcriptional changes with protein abundance would reveal post-transcriptional regulation

  • Integration of genomic and proteomic data would clarify structure-function relationships

  • Systems biology modeling would predict environmental responses

  • Multi-omics approaches would identify potential links between RnfD function and other cellular processes, such as prodigiosin biosynthesis

This integrated approach would be particularly valuable for understanding how RnfD function is coordinated with the algicidal activity of H. chejuensis against red-tide dinoflagellates, potentially revealing new ecological insights into marine microbial interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.