Recombinant Hahella chejuensis Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Hahella chejuensis YidC

YidC is a universally conserved membrane protein insertase critical for the integration, folding, and assembly of membrane proteins in bacteria. The recombinant Hahella chejuensis YidC (UniProt ID: Q2S6M5) is a bioengineered version of this protein, expressed in Escherichia coli for research and biochemical studies. It retains the conserved structural and functional features of native YidC, including a five-transmembrane (TM) domain core and a dynamic cytoplasmic loop system .

Core Architecture

FeatureDescriptionSource
Transmembrane domainsFive conserved TM helices arranged in a pentagonal bundle (TM4-5-3-2-6)
Cytoplasmic loopsHelical hairpin domain (HPD) between TM2 and TM3; interacts with ribosomes
Hydrophilic cavityForms a hydrophilic environment on the cytoplasmic side for substrate capture
Lipid interactionsInduces ~7–10 Å membrane thinning near TM3/TM5 to facilitate insertion

The recombinant protein includes an N-terminal His-tag for purification and structural studies .

Key Roles in Membrane Protein Biogenesis

YidC operates via two primary pathways:

  1. Autonomous Insertion

    • Directly integrates small hydrophobic substrates (e.g., Pf3 coat protein) into membranes .

    • Accelerates insertion of substrates with extended hydrophobic regions .

  2. SecY Cooperation

    • Facilitates lateral movement of TM segments from the SecY channel into the lipid bilayer .

    • Acts as a foldase for polytopic proteins (e.g., melibiose permease MelB), preventing misfolding .

Substrate Binding:

  • Ribosome Interactions: C1 and C2 cytoplasmic loops recruit translating ribosomes via SRP/FtsY pathways .

  • Substrate Chaperoning: Hydrophilic cavity stabilizes polar regions of nascent chains during translocation .

Research Applications

ApplicationExperimental ApproachRelevance
Structural StudiesCryo-EM, molecular dynamics simulationsElucidates YidC-ribosome interactions
Functional AssaysLipid bilayer reconstitution, cross-linkingDemonstrates Sec-independent insertion
ELISA DetectionRecombinant YidC-specific antibodiesQuantifies protein expression

Mechanistic Insights

  1. Co-Translational Insertion

    • YidC binds the ribosome at the tunnel exit to receive nascent chains .

    • Hydrophobic mismatch between TM helices and lipids creates a "thinning" effect, easing substrate insertion .

  2. Polytopic Protein Folding

    • YidC chaperones sequential folding of MelB domains, preventing aggregation .

    • Acts as a "holdase" for partially folded intermediates .

  3. Evolutionary Conservation

    • Homologs include mitochondrial Oxa1 and chloroplast Alb3, highlighting conserved topology .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
yidC; HCH_07087; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-570
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
yidC
Target Protein Sequence
MDFLRTSLIVGLLVVSYLLVLEWNEDMSPQQQPVAQTPSVTIDSNGADSSALLNSPNTGE LDTPETASKPATAEDSNISSTASSGKIITVITDVLRVEIDLNGGNVVEASLLQYPISLKN PTPLDLMQKNNGVYYVAASSLIGANGFDDSKNGGNPIYIAEKNSYSLQEGQDKLSVDLRT ERDGVTIVKRYEFEKSSYSINVNFQINNQSDAPWKANFSAKLVRDKSPDPTFSGGFGAAS FLGAVVSTPEKPYEKIDFSDMEESGPSGVKVNSSNGWIAFIQHYFVSAWIPLSNDTHTYQ TRLRNGLYLMGFVDPEFTVEPGQTHNVGAKLYAGPKIMETLKEVAPNLDLTVDFGWLWLI AKPLYLVLEFIHDYVGNWGIAIILLTVLIKALFFHLSATSYRSMANMRRVTPEMQRIREQ YGDDRQRMSQAMMELYKKEKINPLGGCLPMLVQMPVFISLYWVLLESVQLRQAPFFFWIQ DLSIKDPYFVLPLLMGAAMFLQTSLNPTPPDPIQARVMKMMPIIFTVFFLWFPAGLVLYW LVNNILSIAQQWYITKKIENGGLAAKKIAS
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. Involved in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Membrane Protein Insertase YidC and what is its biological significance?

Membrane Protein Insertase YidC from Hahella chejuensis is a 570-amino acid protein that functions as a critical membrane protein folding and insertion factor in this marine bacterium. The protein belongs to the evolutionarily conserved YidC/Oxa1/Alb3 family that facilitates the insertion, folding, and assembly of proteins into cellular membranes. In bacterial systems, YidC can function either independently or in cooperation with the Sec translocon to ensure proper membrane protein integration .

How does H. chejuensis YidC compare structurally to YidC proteins from other bacterial species?

H. chejuensis YidC maintains the core structural elements found in other bacterial YidC proteins but exhibits specific sequence variations that may reflect adaptation to its marine environment. The full-length protein (570 amino acids) contains the characteristic membrane-spanning domains and a periplasmic domain that are essential for substrate recognition and insertion function .

Comparative analysis indicates H. chejuensis YidC contains the following key structural elements:

  • N-terminal periplasmic domain involved in substrate recognition

  • Five transmembrane helices that form the hydrophobic sliding track for substrate proteins

  • A conserved positively charged region in the cytoplasmic loop that interacts with substrate proteins

Unlike some gram-negative bacteria that possess two YidC paralogs (YidC1 and YidC2), genomic analysis of H. chejuensis suggests it contains a single YidC protein, similar to E. coli. This suggests functional conservation of the core membrane protein insertion machinery across diverse bacterial species, though the specific substrate preferences may differ based on the organism's physiological requirements and environmental adaptations .

What experimental approaches are most effective for studying YidC function in vitro?

Effective study of YidC function requires a multi-faceted approach that combines biochemical, biophysical, and structural biology techniques:

  • Reconstitution systems: For functional studies, purified recombinant YidC should be reconstituted into liposomes or nanodiscs that mimic the native membrane environment. This allows for controlled assessment of insertion activity using fluorescently labeled substrate proteins.

  • Co-immunoprecipitation assays: To identify interaction partners and substrate proteins, tagged recombinant YidC can be used to pull down associated proteins from bacterial lysates.

  • Site-directed mutagenesis: Systematic mutation of conserved residues followed by functional assays can identify critical regions for substrate binding and insertion activity.

  • Cross-linking studies: Chemical cross-linking combined with mass spectrometry can capture transient interactions between YidC and substrate proteins during the insertion process.

  • Cryo-electron microscopy: For structural characterization, single-particle cryo-EM has proven valuable for visualizing YidC alone or in complex with substrate proteins.

The recombinant H. chejuensis YidC with a His-tag offers advantages for these approaches, as the affinity tag facilitates efficient purification while typically maintaining functional integrity of the protein . Researchers should validate that the tag doesn't interfere with function using complementation assays in YidC-depleted bacterial strains.

What expression systems yield optimal production of functional recombinant H. chejuensis YidC?

Based on current research protocols, E. coli-based expression systems have proven most effective for recombinant production of H. chejuensis YidC. The available commercial preparation utilizes E. coli as the expression host for the full-length protein (amino acids 1-570) with an N-terminal His-tag . Several considerations are critical when selecting an expression system:

  • Expression strain selection: E. coli C41(DE3) or C43(DE3) strains, derived from BL21(DE3), are specifically engineered for membrane protein expression and typically yield better results than standard BL21 strains for YidC.

  • Induction conditions: Low-temperature induction (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) over extended periods (16-20 hours) minimizes inclusion body formation and promotes proper membrane integration.

  • Media formulation: Auto-induction media or supplemented minimal media can enhance membrane protein yields compared to standard LB media.

  • Codon optimization: Since H. chejuensis uses different codon preferences than E. coli, codon optimization of the yidC gene sequence can significantly improve expression levels.

Alternative expression systems, including cell-free translation systems supplemented with lipids or nanodiscs, have shown promise for difficult membrane proteins but require specialized equipment and expertise. For most research applications, E. coli remains the most accessible and effective system for H. chejuensis YidC expression .

What purification strategies maximize yield and activity of recombinant YidC?

Effective purification of membrane proteins like YidC requires careful consideration of detergents and buffer conditions to maintain structural integrity and function. A methodological purification strategy includes:

  • Membrane fraction isolation: After cell lysis, differential centrifugation separates membrane fractions containing overexpressed YidC.

  • Detergent solubilization: Mild detergents such as n-dodecyl-β-D-maltopyranoside (DDM), n-decyl-β-D-maltopyranoside (DM), or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration effectively solubilize YidC while preserving function.

  • IMAC purification: The His-tagged protein can be purified using Ni-NTA affinity chromatography, with detergent maintained throughout all buffers. Imidazole gradients (20-250 mM) are recommended for specific elution.

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography in detergent-containing buffer separates aggregates and improves homogeneity.

  • Quality assessment: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) provides critical information about the oligomeric state and detergent/protein ratio.

For the recombinant His-tagged H. chejuensis YidC, purification yields protein with >90% purity as determined by SDS-PAGE . The purified protein can be stored as a lyophilized powder or maintained in buffer containing 6% trehalose at -20°C/-80°C to preserve activity during storage .

How can researchers overcome common challenges in membrane protein purification for YidC?

Membrane protein purification presents several challenges that can be addressed with specific strategies relevant to YidC:

  • Low expression levels: Utilizing specialized strains like C41(DE3) combined with extended induction times at lower temperatures (16-18°C) can improve yields significantly. Additionally, fusion tags like MBP (maltose-binding protein) can enhance solubility and expression.

  • Protein aggregation: Screening multiple detergents is crucial, with DDM, LMNG, and GDN (glyco-diosgenin) showing particular promise for YidC family proteins. Including glycerol (10%) and specific lipids (E. coli polar lipid extract) in purification buffers helps maintain native-like environment.

  • Loss of activity: Minimizing time in detergent by moving quickly through purification steps and immediately reconstituting into proteoliposomes or nanodiscs preserves function. Activity assays should be performed at each purification step to monitor functional integrity.

  • Detergent removal: For functional studies, detergent must be efficiently removed during reconstitution. Bio-Beads SM-2 or detergent absorption with cyclodextrin provides controlled detergent removal without protein denaturation.

  • Heterogeneity: Combining SEC with dynamic light scattering analysis helps identify and separate different oligomeric states or conformations of YidC that may affect functional studies.

For recombinant H. chejuensis YidC, reconstitution into buffers containing 6% trehalose at pH 8.0 appears to provide optimal stability . Repeated freeze-thaw cycles should be avoided, and working aliquots are best maintained at 4°C for up to one week to prevent activity loss .

How does the presence of a His-tag affect the structural integrity and function of recombinant YidC?

The N-terminal His-tag in recombinant H. chejuensis YidC serves as a valuable purification tool but may influence protein behavior in several ways:

  • Structural impact: The additional positively charged histidine residues can potentially alter the electrostatic properties of the N-terminal region, which may influence interactions with negatively charged phospholipid headgroups or substrate proteins.

  • Oligomerization effects: His-tags can sometimes promote non-physiological protein-protein interactions, potentially affecting the oligomeric state of YidC. Native YidC typically functions as a monomer or dimer, but artificial oligomerization could affect functional studies.

  • Metal ion binding: The histidine residues can bind divalent metal ions besides nickel (used in purification), potentially introducing conformational changes or affecting assay results that involve metal ions.

  • Cleavage considerations: While many recombinant proteins include protease cleavage sites for tag removal, the commercial H. chejuensis YidC preparation does not specify a cleavable linker between the His-tag and protein . This may necessitate working with the tagged version for downstream applications.

To assess the potential impact of the His-tag, researchers should consider:

  • Comparing activity of tagged versus untagged protein (if available)

  • Including appropriate controls in binding assays to account for potential His-tag interactions

  • Validating oligomeric state by analytical ultracentrifugation or SEC-MALS

  • Testing multiple buffer conditions to minimize tag-related artifacts

For many applications, the His-tagged recombinant YidC remains functionally active, particularly when proper folding and membrane integration have been achieved during expression and purification .

What functional assays best demonstrate the insertase activity of YidC?

Several complementary functional assays can effectively demonstrate and quantify the insertase activity of purified recombinant H. chejuensis YidC:

  • Proteoliposome-based insertion assays: This gold-standard approach involves reconstituting purified YidC into liposomes, then monitoring the insertion of radiolabeled or fluorescently tagged substrate proteins. Successful insertion can be verified by protease protection assays, where properly inserted portions of the substrate protein are protected from externally added proteases.

  • Förster resonance energy transfer (FRET): By labeling YidC and substrate proteins with compatible FRET pairs, researchers can monitor binding interactions and conformational changes during the insertion process in real-time.

  • Site-specific crosslinking: Using amber suppression technology to incorporate photoreactive amino acids at specific positions in YidC allows for capturing transient interactions with substrate proteins during insertion.

  • Complementation assays: YidC-depleted E. coli strains show growth defects that can be complemented by functional YidC proteins. Expressing H. chejuensis YidC in such strains provides a physiological readout of insertion function.

  • Model substrate insertion: Using well-characterized YidC-dependent substrates like Pf3 coat protein or subunit c of the F1Fo ATP synthase provides standardized systems to assess insertion activity.

Each assay provides different insights into YidC function, and combining multiple approaches provides the most comprehensive functional characterization. When working with H. chejuensis YidC, researchers should consider that substrate preferences may differ from those of E. coli YidC, potentially requiring identification of native H. chejuensis substrate proteins for optimal activity measurements .

What are the optimal storage and handling conditions for maintaining recombinant YidC activity?

Maintaining the activity of recombinant H. chejuensis YidC requires careful attention to storage and handling conditions. Based on the available information, the following protocol is recommended:

  • Storage formulation: The lyophilized protein should be reconstituted in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 . This formulation helps maintain structural integrity during freeze-thaw cycles.

  • Reconstitution procedure: Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Long-term storage: For long-term storage, addition of glycerol to a final concentration of 50% is recommended, followed by aliquoting and storage at -20°C or preferably -80°C .

  • Working stock handling: Working aliquots should be stored at 4°C and used within one week to ensure maximal activity .

  • Freeze-thaw considerations: Repeated freeze-thaw cycles should be strictly avoided as membrane proteins are particularly susceptible to denaturation during this process . Multiple small aliquots are preferable to a single large stock.

The effectiveness of these storage conditions is evident from the maintained purity (>90% as determined by SDS-PAGE) of the commercial preparation . For specialized applications such as crystallization or advanced biophysical studies, further optimization of buffer components may be necessary.

How can researchers design experiments to study YidC interactions with other cellular components?

Designing experiments to study YidC interactions with other cellular components requires approaches that preserve the native membrane environment while enabling specific detection of interaction partners:

  • Co-immunoprecipitation with membrane fractions: Using anti-His antibodies to pull down the His-tagged H. chejuensis YidC from solubilized membrane fractions can identify stable interaction partners. Mass spectrometry analysis of co-precipitated proteins reveals potential interaction networks.

  • Bacterial two-hybrid systems: Modified bacterial two-hybrid systems adapted for membrane proteins can detect YidC interactions with other membrane proteins or soluble factors in vivo.

  • In vivo chemical crosslinking: Cell-permeable crosslinkers applied to cells expressing H. chejuensis YidC can capture transient interactions that might be lost during conventional purification procedures.

  • Fluorescence microscopy with protein complementation: Split fluorescent protein complementation (BiFC) with YidC fused to one fragment and potential interaction partners fused to complementary fragments enables visualization of interactions in living cells.

  • Genetic suppressor screens: In YidC-depleted strains complemented with H. chejuensis YidC, identifying suppressor mutations that restore function in YidC variants can reveal important functional interactions.

  • Ribosome profiling: To identify nascent substrates of YidC, ribosome profiling of strains with and without functional YidC can identify transcripts whose translation is affected by YidC activity.

When studying H. chejuensis YidC in heterologous systems like E. coli, researchers should consider potential differences in interaction partners compared to the native organism. Comparative studies with E. coli YidC can help distinguish conserved interactions from species-specific ones .

What reconstitution methods are most effective for functional studies of YidC?

Effective reconstitution of purified H. chejuensis YidC into membrane mimetic systems is critical for functional studies. Several approaches have proven successful for YidC proteins:

  • Proteoliposome reconstitution: This classical approach involves:

    • Mixing purified YidC in detergent with preformed liposomes (typically E. coli polar lipid extract)

    • Detergent removal via Bio-Beads SM-2 adsorption or dialysis

    • Verification of incorporation by flotation on sucrose gradients

    • Assessment of orientation using protease accessibility assays

  • Nanodisc incorporation: For applications requiring a defined, soluble system:

    • Mixing purified YidC with appropriate membrane scaffold proteins (MSPs) and lipids

    • Controlled detergent removal to form homogeneous nanodiscs

    • Purification by size exclusion chromatography

    • Advantages include defined stoichiometry and enhanced stability for structural studies

  • Polymer-based systems: Alternative approaches using:

    • Styrene-maleic acid lipid particles (SMALPs) that extract membrane proteins with surrounding native lipids

    • Amphipols that wrap around the hydrophobic transmembrane regions

    • These approaches better preserve the native lipid environment but may be less suitable for functional insertion assays

Each reconstitution method presents different advantages:

Reconstitution MethodAdvantagesLimitationsBest Applications
ProteoliposomesNative-like bilayer, substrate insertion possibleHeterogeneous orientation, limited stabilityFunctional insertion assays
NanodiscsDefined size, enhanced stability, soluble systemComplex preparation, limited lipid contentStructural studies, binding assays
SMALPs/AmphipolsPreserves native lipid interactionsLess control over compositionMass spectrometry, native interaction studies

For recombinant H. chejuensis YidC, researchers should consider including marine-specific lipids that might better mimic the native membrane environment of this organism, potentially enhancing activity in functional assays .

How might YidC function contribute to the ecological fitness of H. chejuensis in marine environments?

The YidC function in H. chejuensis likely contributes significantly to the organism's ecological fitness in challenging marine environments through several mechanisms:

  • Adaptation to osmotic stress: Marine bacteria must cope with high salt concentrations, requiring proper insertion of membrane transporters and channels that maintain ion homeostasis. YidC facilitates the assembly of these critical membrane proteins, potentially with adaptations specific to marine conditions.

  • Environmental sensing: H. chejuensis produces bioactive compounds that target specific marine microorganisms like the red-tide dinoflagellate Cochlodinium polykrikoides . The membrane-associated signaling proteins required for detecting environmental cues and competing organisms likely depend on YidC for proper insertion and function.

  • Temperature adaptation: Marine environments often experience temperature fluctuations, and membrane fluidity must be regulated accordingly. YidC may help insert proteins involved in homeoviscous adaptation, such as fatty acid desaturases that modify membrane lipid composition.

  • Competitive advantage: The production of prodigiosin by H. chejuensis provides an algicidal function against competing microorganisms . This specialized metabolism likely requires membrane-embedded proteins for biosynthesis, transport, or regulation that depend on YidC for proper assembly.

  • Biofilm formation: Marine bacteria often form biofilms on surfaces to enhance survival. The membrane proteins involved in adhesion, communication, and matrix production potentially require YidC for integration into the membrane.

Comparative genomic analysis suggests that host-dependent bacteria have different proportions of genes dedicated to various cellular functions compared to free-living bacteria . As a free-living marine bacterium, H. chejuensis likely maintains a robust membrane protein insertion machinery, including YidC, to support its diverse physiological capabilities in a challenging and competitive environment.

What connections might exist between YidC function and secondary metabolite production in H. chejuensis?

The potential connections between YidC function and secondary metabolite production in H. chejuensis represent an intriguing area for research that integrates membrane biology with specialized metabolism:

  • Biosynthetic enzyme assembly: H. chejuensis produces valuable secondary metabolites including prodigiosin (with algicidal and potential therapeutic properties) and chejuenolides (unusual 17-membered carbocyclic tetraenes) . The biosynthetic gene clusters for these compounds (hap cluster for prodigiosin, che cluster for chejuenolides) likely encode membrane-associated components that require YidC for proper insertion.

  • Transport systems: Effective production of secondary metabolites often requires specialized transport systems for precursor uptake and product export. The che gene cluster in H. chejuensis includes non-ribosomal peptide synthase (NRPS)-polyketide synthase (PKS) hybrid systems whose products may require YidC-dependent transporters for cellular export.

  • Regulatory mechanisms: Secondary metabolite production in bacteria is typically regulated by environmental sensing systems that often include membrane-spanning components. The production of prodigiosin in H. chejuensis is regulated by a two-component signal transduction system (HapXY) , which may depend on YidC for proper membrane integration of sensor kinase components.

  • Metabolic compartmentalization: Efficient secondary metabolism often involves spatial organization within the cell. YidC may participate in the assembly of membrane microdomains that co-localize enzymes involved in specialized metabolic pathways.

  • Resistance mechanisms: Organisms producing antibacterial compounds must protect themselves from these compounds. YidC could be involved in assembling membrane proteins that confer self-resistance.

The algicidal function of H. chejuensis against Cochlodinium polykrikoides is attributed to prodigiosin , suggesting that proper production and potentially export of this compound provides an ecological advantage. YidC-dependent membrane protein assembly may therefore be critical not only for basic cellular functions but also for the specialized ecology and chemical biology of this marine bacterium.

What emerging technologies could advance our understanding of YidC structure and function?

Several cutting-edge technologies are poised to significantly advance our understanding of YidC structure and function, with particular relevance to H. chejuensis YidC:

  • Cryo-electron microscopy (cryo-EM) advances:

    • Single-particle cryo-EM has revolutionized membrane protein structural biology

    • Time-resolved cryo-EM could capture YidC in different conformational states during substrate insertion

    • Cryo-electron tomography combined with subtomogram averaging can visualize YidC in its native membrane environment

  • Integrative structural biology approaches:

    • Combining multiple techniques (X-ray crystallography, NMR, SAXS, cryo-EM) for comprehensive structural models

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces between YidC and substrates

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions during substrate processing

  • Advanced fluorescence techniques:

    • Single-molecule FRET to track conformational changes during insertion

    • Super-resolution microscopy to visualize YidC distribution and dynamics in living cells

    • Fluorescence correlation spectroscopy to measure binding kinetics with substrate proteins

  • Computational methods:

    • AlphaFold2 and RoseTTAFold can predict YidC structures and substrate interactions

    • Molecular dynamics simulations to model insertion processes in atomic detail

    • Systems biology approaches to integrate YidC function into whole-cell models

  • Genome engineering tools:

    • CRISPR-Cas9 editing of H. chejuensis to create YidC variants and assess phenotypic effects

    • Directed evolution approaches to optimize YidC for specific substrates or conditions

    • In vivo deep mutational scanning to comprehensively map functional residues

The structural and functional insights gained from these technologies could have significant implications for understanding fundamental membrane protein biology and potentially for biotechnological applications. For instance, engineered YidC variants could improve membrane protein production for structural studies or enhance the biosynthesis of valuable compounds like prodigiosin that have potential pharmaceutical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.