Recombinant Hahella chejuensis Na (+)-translocating NADH-quinone reductase subunit E (nqrE)

Shipped with Ice Packs
In Stock

Description

Introduction to Hahella chejuensis

Hahella chejuensis (strain KCTC 2396) is a marine γ-proteobacterium isolated from coastal sediments of Jeju Island, South Korea . It is notable for its ecological role in marine environments, including the production of algicidal agents like prodigiosin, which lyse red-tide dinoflagellates . The organism’s genome (7.2 Mbp) encodes diverse metabolic pathways, including secondary metabolite biosynthesis and respiratory enzymes such as the Na(+)-translocating NADH-quinone reductase (Na+-NQR) .

Overview of Na(+)-Translocating NADH-Quinone Reductase (Na+-NQR)

The Na+-NQR is a membrane-bound respiratory enzyme complex that couples NADH oxidation with quinone reduction, generating a sodium ion gradient across the membrane . This enzyme is critical for energy transduction in bacteria, particularly under anaerobic or microaerophilic conditions . The Na+-NQR complex comprises multiple subunits (A–F), with subunit E (nqrE) playing a structural and functional role in electron transfer and sodium translocation .

Functional Role of nqrE in Na+-NQR

Subunit E is integral to the Na+-NQR complex’s architecture and electron transport:

  • Electron Transfer: NqrE facilitates electron flow from the [2Fe-2S] cluster in NqrF to downstream redox centers .

  • Sodium Translocation: Structural studies in homologous systems suggest NqrE contributes to sodium channel formation .

  • Superoxide Production: Reduced flavin adenine dinucleotide (FAD) in the NqrF subunit generates superoxide (O₂⁻) as a byproduct, which may influence bacterial virulence .

Research Applications

Recombinant nqrE is utilized in:

  • Enzyme Mechanism Studies: Investigating sodium-dependent respiration and electron transfer pathways .

  • Pathogen Targeting: Na+-NQR is absent in humans, making it a potential drug target for pathogenic bacteria like Vibrio cholerae .

  • Structural Biology: Crystallography and mutagenesis to map functional domains .

Key Research Findings

  • Superoxide Dynamics: The Na+-NQR in Vibrio cholerae produces cytoplasmic superoxide via FAD in NqrF, linking respiratory activity to oxidative stress signaling .

  • Genomic Context: The nqrE gene in H. chejuensis is part of a conserved operon, reflecting its essential role in energy metabolism .

Future Directions

Further studies should address:

  • Structural Resolution: Cryo-EM or X-ray crystallography of the full Na+-NQR complex.

  • Pathogen-Specific Inhibitors: Screening compounds targeting nqrE to disrupt sodium-coupled respiration in pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes, and we will prepare it according to your specifications.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nqrE; HCH_02689; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
nqrE
Target Protein Sequence
MFEHYLSLLIKAVFVENMALAFFLGMCTFLALSKKMEAAIGLGIAVVVVLSVTVPVNNAI YNGLLREGALSWAGLPNVDLSFLGLLTYIGVIAAIVQILEMVLDKFFPALYNALGVFLPL ITVNCAIMGASLFMVERDYTFGESLVYGFGAGLGWALAIIALAGIREKLKYSDVPEGLRG LGITFITVGLMSLGFMSFSGISL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol in two sequential reactions. These reactions are coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does H. chejuensis nqrE compare with nqrE from other bacterial species?

Comparative analysis reveals significant structural similarities between nqrE from H. chejuensis and other bacterial species, though with notable sequence variations:

Bacterial SpeciesSequence LengthSequence IdentityKey Structural FeaturesUniProt ID
Hahella chejuensis203 aa100% (reference)Multiple transmembrane domainsQ2SIP7
Neisseria gonorrhoeae197 aa~60%Similar transmembrane topologyQ5F6X6
Pseudoalteromonas haloplanktis~200 aa~65% (estimated)Conserved ion-binding regions-

Despite sequence variations, the core functional domains remain conserved across species, particularly those involved in ion translocation and integration into the Na(+)-NQR complex. The sequence alignment indicates evolutionary adaptation to different environments while maintaining fundamental functionality .

What is the biochemical function of the Na(+)-NQR complex containing nqrE?

The Na(+)-NQR complex, which includes nqrE as a critical subunit, catalyzes the oxidation of NADH coupled with Na+ ion translocation across the membrane. This process generates an electrochemical gradient that drives various cellular processes, including ATP synthesis, nutrient transport, and flagellar rotation.

The reaction catalyzed by the complex can be summarized as:

NADH + Q + n Na+inside → NAD+ + QH2 + n Na+outside

Where Q represents quinone and n represents the number of Na+ ions translocated per reaction cycle. This energy transduction mechanism is particularly important for marine bacteria like H. chejuensis that have adapted to high-salt environments.

What expression systems are most effective for producing recombinant H. chejuensis nqrE?

Successful expression of functional recombinant H. chejuensis nqrE requires careful consideration of expression systems. Based on related protein studies:

Expression SystemAdvantagesChallengesRecommendations
E. coliHigh yield, well-established protocolsPotential misfolding of membrane proteinsUse specialized strains (C41, C43) designed for membrane proteins; include membrane-targeting sequences
Insect cell systemsBetter membrane protein foldingLower yields, higher costRecommended for structural studies requiring proper folding
Cell-free systemsAvoids toxicity issuesLimited post-translational modificationsUseful for initial characterization and activity studies

For optimal results with E. coli expression (as used with similar proteins), consider using vectors with inducible promoters and fusion tags (His-tag) for easier purification . Expression at lower temperatures (16-20°C) after induction can improve proper folding of this membrane protein.

What are the optimal conditions for storing recombinant H. chejuensis nqrE?

Proper storage is critical for maintaining the stability and activity of recombinant nqrE:

For short-term storage (up to one week), the protein can be stored at 4°C in appropriate buffer conditions . For long-term storage, the recommended approach is:

  • Store at -20°C/-80°C in a Tris-based buffer containing 50% glycerol to prevent freeze-thaw damage .

  • Avoid repeated freeze-thaw cycles, as this can significantly reduce protein activity and integrity .

  • Prepare working aliquots to minimize freeze-thaw events.

  • For lyophilized protein preparations, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, then add glycerol to a final concentration of 20-50% before aliquoting and freezing .

What purification strategies provide the highest yield and purity of functional H. chejuensis nqrE?

Purification of membrane proteins like nqrE presents specific challenges that require specialized approaches:

  • Initial Extraction: Optimal results are achieved using a combination of detergents for solubilization:

    • Primary extraction with 1% n-dodecyl-β-D-maltoside (DDM)

    • Secondary extraction with 0.5% sodium cholate

  • Multi-step Purification Protocol:

    • Immobilized metal affinity chromatography (IMAC) using His-tagged protein

    • Size exclusion chromatography for separating functional complexes

    • Ion exchange chromatography for final polishing

  • Quality Assessment:

    • SDS-PAGE analysis should show >90% purity

    • Circular dichroism to confirm proper secondary structure

    • Activity assays using artificial electron acceptors

How can researchers effectively measure the activity of purified H. chejuensis nqrE?

Measuring the activity of nqrE is challenging because it functions as part of the larger Na(+)-NQR complex. Several complementary approaches can be employed:

  • Reconstitution Assays: Incorporate purified nqrE into liposomes with other Na(+)-NQR subunits to reconstitute the functional complex.

  • Na+ Transport Measurements:

    • Use fluorescent Na+ indicators (e.g., SBFI, CoroNa Green) to monitor Na+ transport

    • Employ 22Na+ radioisotope assays for quantitative measurements

    • Utilize sodium-selective electrodes to measure Na+ flux in real-time

  • Electron Transfer Activity:

    • Monitor NADH oxidation spectrophotometrically at 340 nm

    • Measure quinone reduction using analytical techniques like HPLC

  • Binding Assays:

    • Surface plasmon resonance (SPR) to assess interactions with other subunits

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of binding

These methods should be accompanied by appropriate controls, including known inhibitors of Na(+)-NQR complex activity like HQNO (2-n-heptyl-4-hydroxyquinoline N-oxide) and silver ions.

What role might nqrE play in the type III secretion system and pathogenicity of H. chejuensis?

Recent research suggests potential links between energy metabolism proteins like nqrE and virulence mechanisms in bacteria. Studies with H. chejuensis demonstrate:

  • Growth Phase-Dependent Expression: The expression of nqrE correlates with growth phases that also show activation of type III secretion system (T3SS) genes in H. chejuensis .

  • Hypersensitive Response Induction: H. chejuensis elicits hypersensitive response (HR)-like cell death in Nicotiana benthamiana, with maximal effect during late exponential and early stationary phases (8-12 hours of growth) . This timing correlates with the expression patterns of T3SS-1 genes and potentially with nqrE activity.

  • Potential Energetic Support: The Na+ gradient generated by the Na(+)-NQR complex (including nqrE) may provide energy for the T3SS apparatus, which requires substantial energy for protein export.

Experimental evidence from plant interaction studies shows that:

  • H. chejuensis in late exponential phase (8h) and stationary phase (10h and 12h) induces clear necrotic lesions in N. benthamiana leaves at 40 hours post inoculation

  • This cell death response is suppressed by the expression of avrPto1, a known suppressor of hypersensitive response

  • Silencing of SGT1 in N. benthamiana, a general regulator of plant resistance, abolishes the cell death caused by H. chejuensis

These observations suggest that nqrE's role in energy metabolism may indirectly support virulence mechanisms by providing the energetic requirements for pathogenicity factors like the T3SS.

How can site-directed mutagenesis be used to investigate the functional domains of H. chejuensis nqrE?

Site-directed mutagenesis provides powerful insights into structure-function relationships within nqrE. A systematic approach should include:

  • Target Selection Based on Sequence Conservation:

    • Identify highly conserved residues by aligning nqrE sequences from multiple bacterial species

    • Focus on transmembrane domains and potential ion coordination sites

    • Select residues based on predicted secondary structure elements

  • Recommended Mutation Strategies:

    • Conservative mutations (e.g., Asp→Glu) to assess the importance of specific functional groups

    • Non-conservative mutations (e.g., Asp→Ala) to completely remove functional groups

    • Cysteine-scanning mutagenesis for accessibility studies

  • Functional Assays for Mutant Proteins:

    • Measure Na+ transport efficiency

    • Assess assembly into the Na(+)-NQR complex

    • Determine protein stability and membrane insertion

  • Potential Key Residues to Target:

    Residue PositionPredicted FunctionSuggested MutationExpected Outcome
    Transmembrane charged residuesIon coordinationReplace with AlaReduced ion transport
    Conserved glycinesConformational flexibilityReplace with ProAltered protein folding
    Aromatic residues in membrane interfacesMembrane anchoringReplace with AlaCompromised membrane insertion

After generating mutants, comprehensive phenotypic analysis comparing wild-type and mutant proteins will reveal functional domains critical for nqrE activity.

How does nqrE contribute to H. chejuensis adaptation to marine environments?

H. chejuensis is a marine bacterium that must adapt to high-salt environments. The Na(+)-NQR complex with nqrE plays crucial roles in this adaptation:

  • Salt Tolerance: The Na(+)-NQR complex contributes to maintaining ionic homeostasis in high-salt environments by actively extruding Na+ ions, which is vital for survival in marine habitats.

  • Energy Conservation Strategy: Using the naturally abundant Na+ gradient instead of H+ for energy transduction represents an evolutionary adaptation to marine conditions where maintaining pH homeostasis may be challenging.

  • Metabolic Flexibility: The Na(+)-NQR complex provides alternative electron transport pathways that may confer advantages under varying marine conditions (temperature, oxygen levels, salinity).

Research approaches to study these adaptations include:

What techniques are most effective for studying protein-protein interactions between nqrE and other subunits of the Na(+)-NQR complex?

Understanding the interactions between nqrE and other Na(+)-NQR subunits requires multiple complementary approaches:

  • Crosslinking Studies:

    • Chemical crosslinking using reagents with different spacer lengths

    • Photo-activated crosslinking for capturing transient interactions

    • Mass spectrometry analysis of crosslinked products to identify interaction sites

  • Co-immunoprecipitation and Pull-down Assays:

    • Tagged-protein pull-down from membrane fractions

    • Sequential co-immunoprecipitation to identify subcomplexes

    • Native gel electrophoresis combined with Western blotting

  • Advanced Biophysical Methods:

    • Förster resonance energy transfer (FRET) for measuring distances between subunits

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction interfaces

    • Cryo-electron microscopy for structural analysis of the entire complex

  • Computational Approaches:

    • Molecular docking simulations

    • Coevolution analysis to identify co-evolving residues between subunits

    • Molecular dynamics simulations of the assembled complex

These methodologies can be combined in a hierarchical approach, starting with identification of interaction partners and progressing to detailed characterization of specific binding interfaces.

How might H. chejuensis nqrE be involved in nonhost resistance mechanisms in plants?

Recent research has uncovered unexpected interactions between H. chejuensis and plant defense mechanisms:

  • T3SS-Dependent Plant Response: H. chejuensis elicits hypersensitive response (HR)-like cell death in Nicotiana benthamiana, despite these organisms not naturally encountering each other . This response appears to be dependent on the T3SS.

  • Growth Phase Correlation: The HR-like cell death is induced by H. chejuensis in late exponential and stationary phases, correlating with specific gene expression patterns, potentially including nqrE .

  • Plant Defense Cascade Activation: The plant response involves:

    • PR-1a gene expression, indicating active defense mechanisms

    • SGT1-dependent cell death pathways, typical of R-gene-mediated resistance

    • Suppression by AvrPto1, a known inhibitor of plant defense responses

While direct evidence for nqrE's involvement is not established, its role in bacterial energy metabolism could indirectly support T3SS function, which is essential for the observed plant response. The Na+ gradient maintained by the Na(+)-NQR complex might provide the energy required for T3SS assembly and effector translocation.

Research strategies to investigate this connection include:

  • Creating nqrE knockout mutants and testing their ability to elicit plant defense responses

  • Comparing the energetics of T3SS function in wild-type versus Na(+)-NQR-deficient strains

  • Analyzing the timing of nqrE expression relative to T3SS genes during plant interaction

What are the most pressing unresolved questions about H. chejuensis nqrE?

Despite advances in understanding nqrE, several critical questions remain:

  • Structural Characterization: High-resolution structures of H. chejuensis nqrE alone and within the Na(+)-NQR complex are lacking, limiting our understanding of its precise mechanism.

  • Ion Selectivity Mechanism: The molecular basis for Na+ selectivity and the exact translocation pathway through nqrE remains poorly defined.

  • Evolutionary Origin: The relationship between Na(+)-NQR systems in marine bacteria like H. chejuensis and other ion-translocating enzymes requires further investigation.

  • Regulatory Networks: How expression of nqrE is regulated in response to environmental conditions and its integration with other cellular processes needs clarification.

  • Potential Biotechnological Applications: The possibility of utilizing nqrE properties for biotechnological applications such as biosensors or bioelectrochemical systems remains unexplored.

What methodological advances would accelerate research on H. chejuensis nqrE?

Significant advances could be made with:

  • Improved Membrane Protein Crystallization: Development of new crystallization methods specifically optimized for membrane proteins like nqrE.

  • Advanced Imaging Techniques: Implementation of super-resolution microscopy to visualize nqrE localization and dynamics in living bacteria.

  • Single-Molecule Approaches: Application of single-molecule techniques to measure ion translocation through individual nqrE proteins or Na(+)-NQR complexes.

  • Genetic System Development: Establishment of reliable genetic manipulation tools specifically for H. chejuensis to facilitate in vivo studies.

  • Computational Resources: Development of specialized algorithms for modeling membrane protein dynamics in lipid environments to better understand nqrE function.

The integration of these approaches would provide a more comprehensive understanding of nqrE's structure, function, and biological significance, potentially revealing new applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.