Recombinant Hahella chejuensis Protein CrcB homolog (crcB)

What is Hahella chejuensis and why is it significant for research?

Hahella chejuensis is a marine bacterium first sequenced in the Oceanospiralles clade, with a genome size of approximately 7.2 megabases . Its significance lies primarily in its production of prodigiosin, a red pigment with algicidal properties that can mitigate harmful algal blooms . H. chejuensis has been extensively studied for its ecological role in marine environments, particularly in controlling red tide dinoflagellates. The bacterium contains numerous biosynthetic gene clusters that produce various secondary metabolites with potential biotechnological applications, including antimicrobial compounds . Its genome is well-equipped with genes for basic metabolic capabilities and contains a large number of genes involved in regulation or transport, characteristic of a marine heterotroph .

What is the CrcB homolog protein in H. chejuensis and what is its function?

The CrcB homolog protein in Hahella chejuensis (strain KCTC 2396) is a membrane protein encoded by the crcB gene (HCH_02448) . While the specific function of the CrcB homolog in H. chejuensis hasn't been completely characterized, CrcB proteins generally function as fluoride ion channels in bacteria, providing protection against fluoride toxicity by exporting fluoride ions from the cell. The protein consists of 127 amino acids and has a characteristic membrane-spanning structure with hydrophobic regions, as evidenced by its amino acid sequence: MSVPHLVYVALGGALGAVSRYLIVAWVSNVAGAKFPWGTLAVNLLGSFLLGTAFVYVVEKLHGQPELRSLIMVGFLGALTTFSTFSLEAWSLMQSDQLLQGLAYILMSVILCLFAVSAGIALTRLIL . Understanding this protein's structure and function contributes to broader knowledge of ion transport mechanisms and bacterial adaptation to environmental stressors.

What structural and functional relationships exist between the CrcB homolog in H. chejuensis and similar proteins in other marine bacteria?

The CrcB homolog in Hahella chejuensis shares structural similarities with fluoride channels found in other bacterial species, but likely has adaptations specific to the marine environment. Phylogenetic analysis places H. chejuensis as distantly related to the Pseudomonas group, suggesting potential evolutionary divergence in the CrcB protein structure and function . The protein's hydrophobic regions (visible in the amino acid sequence provided in the product documentation) indicate transmembrane domains consistent with its role as an ion channel . Advanced structural analysis techniques such as X-ray crystallography or cryo-electron microscopy would be necessary to determine precise structural differences between the H. chejuensis CrcB homolog and those from other bacterial species. Functional differences might include adaptations to high salt concentrations, variable pH, or specific ion compositions found in marine environments. Comparative genomic analysis coupled with protein modeling could reveal conservation patterns in key functional domains and species-specific variations.

How does the recombinant CrcB homolog interact with prodigiosin biosynthesis pathways in H. chejuensis?

The relationship between the CrcB homolog and prodigiosin biosynthesis represents a complex research question that requires investigation of potential regulatory interactions. Prodigiosin biosynthesis in H. chejuensis involves a cluster of 14 ORFs with high similarities to the red (undecylprodiginine biosynthesis) gene cluster . While there is no direct evidence in the provided search results linking the CrcB homolog to prodigiosin biosynthesis, several hypothetical interactions could exist:

• Ion homeostasis regulated by CrcB may affect enzyme activity within the prodigiosin biosynthetic pathway

• Co-regulation of crcB and prodigiosin genes under specific environmental conditions

• Potential involvement in export or trafficking of pathway intermediates

Research to establish these connections would require techniques such as gene knockout studies, transcriptomic analysis under varying conditions, and protein-protein interaction assays. The elucidation of such interactions would contribute significantly to understanding the integrated cellular processes in H. chejuensis.

What role might the CrcB homolog play in H. chejuensis adaptation to various marine environmental conditions?

As a membrane protein likely involved in ion transport, the CrcB homolog may play a crucial role in adapting H. chejuensis to variable marine environments . Marine bacteria face fluctuating conditions including changes in salinity, pH, temperature, and the presence of toxic compounds. If the CrcB homolog functions similarly to other bacterial CrcB proteins, it would protect H. chejuensis from fluoride toxicity, which can be relevant in marine environments where fluoride concentrations can vary. Additionally, the protein might have evolved additional or modified functions specific to the ecological niche of H. chejuensis. The genomic context analysis reveals that H. chejuensis contains numerous genes associated with environmental adaptation, including those for iron utilization and response to stressors . Investigating the expression patterns of the crcB gene under various environmental conditions (temperature, salinity, pH, presence of competitors or predators) would provide insights into its role in ecological adaptation.

What are the optimal conditions for expression and purification of recombinant H. chejuensis CrcB homolog protein?

Based on available data and standard protocols for membrane proteins, the following methodological approach is recommended for optimal expression and purification of recombinant H. chejuensis CrcB homolog protein:

• Expression System Selection: E. coli BL21(DE3) or C41(DE3) strains are recommended for membrane protein expression, with consideration for codon optimization based on the H. chejuensis sequence.

• Vector Design: Incorporate a fusion tag (His6, MBP, or GST) for detection and purification, with a protease cleavage site for tag removal if necessary.

• Expression Conditions:

  • Initial induction at lower temperatures (16-20°C) to prevent inclusion body formation

  • IPTG concentration: 0.1-0.5 mM

  • Duration: 16-24 hours

  • Media: 2XYT or auto-induction media supplemented with appropriate antibiotics

• Membrane Extraction and Solubilization:

  • Cell lysis via sonication or French press in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (DDM, LDAO, or C12E8)

• Purification Strategy:

  • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA for His-tagged proteins

  • Size exclusion chromatography for final polishing

  • Buffer optimization containing appropriate detergent above CMC

• Storage Considerations: Store in Tris-based buffer with 50% glycerol at -20°C for extended storage, or at -80°C for longer periods. Working aliquots can be maintained at 4°C for up to one week .

This approach should yield purified protein suitable for structural and functional studies while maintaining native conformation of this membrane protein.

What techniques are most effective for characterizing the ion channel activity of the CrcB homolog?

Characterizing the ion channel activity of the CrcB homolog requires specialized techniques that can measure ion flux across membranes. The following methodological approaches are recommended:

• Liposome-Based Flux Assays:

  • Reconstitution of purified CrcB homolog into liposomes with defined lipid composition

  • Loading liposomes with fluorescent ion indicators (e.g., SBFI for sodium, PBFI for potassium)

  • Measuring fluorescence changes upon ion gradient establishment

  • Specific focus on fluoride ion transport using fluoride-sensitive probes

• Planar Lipid Bilayer Electrophysiology:

  • Formation of artificial lipid bilayers incorporating the CrcB homolog

  • Voltage-clamp recordings to measure ion currents

  • Analysis of channel conductance, ion selectivity, and gating properties

  • Testing response to different ion concentrations and membrane potentials

• Patch-Clamp Analysis of Reconstituted Vesicles:

  • Giant unilamellar vesicles (GUVs) containing CrcB homolog

  • Patch-clamp recordings to capture single-channel activity

  • Determination of channel opening probability and conductance states

• Cell-Based Assays:

  • Expression in mammalian cells or oocytes

  • Whole-cell patch-clamp recordings

  • Fluoride toxicity rescue experiments in CrcB-deficient bacterial strains

• Computational Approaches:

  • Molecular dynamics simulations to predict ion permeation pathways

  • Homology modeling based on known CrcB structures

  • Docking studies with potential channel blockers

These techniques, used in combination, would provide comprehensive insights into the ion transport properties of the CrcB homolog and its physiological relevance in H. chejuensis.

What genomic and transcriptomic approaches can reveal the regulation of crcB gene expression?

To elucidate the regulation of crcB gene expression in H. chejuensis, several genomic and transcriptomic approaches can be employed:

• Promoter Analysis and Characterization:

  • In silico identification of potential promoter elements and transcription factor binding sites

  • Reporter gene assays using the crcB promoter region fused to reporter genes (GFP, luciferase)

  • DNA footprinting to identify protein-DNA interactions at the promoter

• RNA-Seq Analysis:

  • Transcriptome profiling under various environmental conditions (salinity, pH, temperature, nutrient availability)

  • Differential expression analysis to identify conditions affecting crcB expression

  • Co-expression network analysis to identify genes with similar expression patterns

• ChIP-Seq (Chromatin Immunoprecipitation Sequencing):

  • Identification of transcription factors binding to the crcB promoter region

  • Genome-wide mapping of protein-DNA interactions

• CRISPR-Cas9 Mediated Genome Editing:

  • Creation of crcB knockout or reporter strains

  • Analysis of phenotypic changes and gene expression patterns in modified strains

• 5' RACE (Rapid Amplification of cDNA Ends):

  • Precise mapping of transcription start sites

  • Identification of alternative promoters if present

• RT-qPCR:

  • Targeted quantification of crcB expression under specific conditions

  • Validation of RNA-Seq findings

  • Time-course studies to capture expression dynamics

These approaches would provide comprehensive insights into the regulatory mechanisms controlling crcB expression and its integration within the broader transcriptional networks of H. chejuensis.

How should researchers design experiments to investigate potential interactions between the CrcB homolog and prodigiosin biosynthesis?

A systematic experimental design to investigate potential interactions between the CrcB homolog and prodigiosin biosynthesis should include the following elements:

• Genetic Manipulation Studies:

  • Generate crcB knockout and overexpression strains in H. chejuensis

  • Quantify prodigiosin production in these strains under various conditions

  • Create reporter fusion constructs to visualize expression patterns

  • Employ complementation studies to verify phenotype specificity

• Transcriptomic Analysis:

  • Compare gene expression profiles between wild-type and crcB mutant strains

  • Focus on expression changes in the prodigiosin biosynthetic gene cluster (14 ORFs) identified in H. chejuensis

  • Analyze co-expression patterns under conditions that stimulate or inhibit prodigiosin production

• Metabolomic Profiling:

  • Implement LC-MS/MS analysis to detect and quantify prodigiosin and intermediates

  • Compare metabolite profiles between wild-type and crcB mutant strains

  • Conduct isotope labeling studies to track metabolic flux through the pathway

• Protein-Protein Interaction Studies:

  • Perform co-immunoprecipitation experiments with tagged CrcB homolog

  • Utilize bacterial two-hybrid system to screen for interactions with prodigiosin biosynthetic enzymes

  • Conduct crosslinking studies followed by mass spectrometry to identify interacting proteins

• Ion Homeostasis Measurements:

  • Measure intracellular ion concentrations in wild-type and crcB mutant strains

  • Correlate ion levels with prodigiosin production

  • Test the effect of external ion supplementation on prodigiosin synthesis

• Environmental Response Analysis:

  • Test the response to various environmental triggers (pH, temperature, nutrient availability)

  • Compare prodigiosin production across a matrix of conditions

  • Analyze crcB expression in response to the same conditions

This multi-faceted approach would provide comprehensive insights into any functional relationships between the CrcB homolog and prodigiosin biosynthesis in H. chejuensis.

What control experiments are essential when working with recombinant H. chejuensis CrcB homolog protein?

When conducting experiments with recombinant H. chejuensis CrcB homolog protein, the following essential control experiments should be included:

• Expression System Controls:

  • Empty vector control (host cells transformed with vector lacking the crcB gene)

  • Non-induced control (cells containing the expression construct but not induced)

  • Positive control (expression of a well-characterized protein using the same system)

• Protein Purification Controls:

  • Purification from empty vector cells to identify host proteins that co-purify

  • Western blot analysis with tag-specific antibodies to confirm identity

  • Mass spectrometry verification of purified protein

  • Size exclusion chromatography to confirm homogeneity

• Functional Assay Controls:

  • Heat-denatured protein control to distinguish active protein function from non-specific effects

  • Alternative ion channels as positive controls for ion transport assays

  • Buffer-only and detergent-only controls to account for non-protein effects

  • Concentration gradients to establish dose-dependent relationships

• Membrane Reconstitution Controls:

  • Liposomes or membrane systems without protein

  • Reconstitution with non-channel membrane proteins

  • Varying lipid compositions to account for membrane effects

• Stability and Storage Controls:

  • Fresh vs. stored protein comparisons

  • Freeze-thaw cycle analysis to determine functional stability

  • Different buffer conditions to optimize activity preservation

• Species-Specific Controls:

  • Parallel experiments with CrcB homologs from related species

  • Comparison with other fluoride channels from diverse organisms

These control experiments ensure that observed effects are specifically attributable to the functional CrcB homolog protein and help identify potential artifacts or limitations in the experimental system.

How can researchers effectively investigate the role of the CrcB homolog in H. chejuensis adaptation to environmental stressors?

To effectively investigate the role of the CrcB homolog in H. chejuensis adaptation to environmental stressors, researchers should implement the following comprehensive experimental design:

• Stress Response Profiling:

  • Subject wild-type H. chejuensis to a matrix of environmental stressors:

    • Salinity gradients (0.5% to 10% NaCl)

    • pH ranges (pH 5.0 to 9.0)

    • Temperature variations (4°C to 45°C)

    • Fluoride concentrations (0.1 mM to 50 mM)

    • Heavy metal exposure (Cu, Zn, Cd, Hg)

    • Oxidative stress (H₂O₂, paraquat)

  • Measure growth rates, survival, and metabolic activities

  • Quantify crcB expression levels under each condition using RT-qPCR

• Genetic Manipulation Approach:

  • Create crcB knockout, knockdown, and overexpression strains

  • Compare stress responses of modified strains to wild-type

  • Conduct complementation studies with native and mutated versions of crcB

  • Perform genome-wide fitness screening (Tn-seq) under stress conditions

• Physiological Assessment:

  • Measure membrane potential changes using voltage-sensitive dyes

  • Quantify intracellular pH during stress exposure

  • Monitor ion fluxes using fluorescent indicators

  • Assess membrane integrity during stress using dye exclusion assays

• Omics Integration:

  • Transcriptome analysis comparing wild-type and crcB mutants under stress

  • Proteome profiling to identify stress-responsive protein networks

  • Metabolomics to detect alterations in metabolic pathways during stress

  • Lipidomics to characterize membrane composition changes

• In situ Ecological Studies:

  • Design microcosm experiments mimicking natural marine environments

  • Compare colonization and persistence of wild-type and crcB mutants

  • Analyze competitive fitness in mixed populations under fluctuating conditions

• Evolutionary Analysis:

  • Compare crcB sequences across Hahella isolates from diverse environments

  • Identify signatures of selection in the crcB gene

  • Reconstruct the evolutionary history of CrcB in marine bacteria

This multi-dimensional approach would provide comprehensive insights into the physiological role of the CrcB homolog in environmental adaptation and stress response in H. chejuensis.

How should researchers approach data analysis for protein-protein interaction studies involving the CrcB homolog?

When analyzing data from protein-protein interaction studies involving the CrcB homolog, researchers should implement the following analytical framework:

• Primary Data Processing:

  • For co-immunoprecipitation (Co-IP) experiments:

    • Implement stringent criteria for positive interactions (signal-to-noise ratio >3)

    • Account for non-specific binding using appropriate negative controls

    • Consider enrichment relative to input rather than absolute values

  • For bacterial two-hybrid systems:

    • Establish clear thresholds for positive interactions

    • Conduct statistical analysis across biological replicates

    • Compare to known positive and negative interaction controls

• Network Analysis:

  • Construct protein interaction networks using visualization tools (Cytoscape, String)

  • Apply clustering algorithms to identify functional modules

  • Calculate network parameters (degree, betweenness centrality) to identify hub proteins

  • Compare topological features with randomized networks

• Validation Strategy:

  • Implement multiple complementary techniques (Co-IP, FRET, SPR, crosslinking-MS)

  • Apply Bayesian integration of data from different methods

  • Establish a confidence scoring system based on reproducibility

  • Create a validation matrix for high-confidence interactions

• Structural Context:

  • Map interaction sites to protein domains and structural features

  • Perform molecular docking to assess biophysical plausibility

  • Evaluate conservation of interaction interfaces across homologs

  • Consider membrane topology constraints for this transmembrane protein

• Functional Classification:

  • Categorize interacting proteins by cellular function and localization

  • Conduct Gene Ontology enrichment analysis of interaction partners

  • Identify overrepresented pathways or processes

  • Correlate with gene expression patterns under relevant conditions

This systematic approach to data analysis ensures robust interpretation of protein-protein interaction data involving the CrcB homolog, minimizing false positives while highlighting biologically significant interactions.

What statistical approaches are most appropriate for analyzing functional differences between wild-type and modified CrcB homolog proteins?

When analyzing functional differences between wild-type and modified CrcB homolog proteins, researchers should employ the following statistical approaches:

• Experimental Design Considerations:

  • Power analysis to determine appropriate sample size

  • Randomized block design to control for batch effects

  • Factorial design to test multiple variables simultaneously

  • Technical and biological replicates (minimum n=3 for each)

• Parametric Statistical Tests:

  • Student's t-test for pairwise comparisons (when assumptions are met)

  • One-way ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple variant comparisons

  • Two-way ANOVA for examining interaction effects between variables

  • Repeated measures ANOVA for time-course data

• Non-Parametric Alternatives:

  • Mann-Whitney U test for non-normally distributed data

  • Kruskal-Wallis test with Dunn's post-hoc for multiple comparisons

  • Friedman test for repeated measures with non-normal distribution

  • Permutation tests for small sample sizes

• Advanced Statistical Methods:

  • Mixed-effects models for nested data structures

  • Multivariate analysis for simultaneous assessment of multiple parameters

  • Principal component analysis for dimensionality reduction

  • Cluster analysis for identifying functional groupings

• Biological Effect Size Estimation:

  • Cohen's d or Hedges' g for standardized mean differences

  • Fold change calculations with confidence intervals

  • Dose-response modeling for concentration-dependent effects

  • EC50/IC50 determination with 95% confidence intervals

How can researchers integrate genomic, transcriptomic, and functional data to develop a comprehensive model of CrcB homolog function in H. chejuensis?

Integrating multi-omics data to develop a comprehensive model of CrcB homolog function requires systematic data synthesis and interpretation. The following methodological framework is recommended:

• Multi-omics Data Collection and Preprocessing:

  • Genomic data: Identify genetic context, regulatory elements, and evolutionary patterns

  • Transcriptomic data: Analyze expression patterns across conditions and co-expression networks

  • Proteomic data: Determine protein abundance, modifications, and interaction partners

  • Metabolomic data: Assess metabolic changes associated with CrcB function

  • Functional assays: Measure ion transport, stress response, and phenotypic characteristics

• Data Integration Approaches:

  • Correlation-based methods: Calculate Pearson or Spearman correlations across datasets

  • Network-based integration: Construct multi-layered networks connecting genes, proteins, and metabolites

  • Bayesian integration: Develop probabilistic models incorporating prior knowledge

  • Machine learning algorithms: Implement supervised and unsupervised methods to identify patterns

  • Causal inference models: Establish directional relationships between variables

• Systems Biology Modeling:

  • Constraint-based modeling: Develop flux balance analysis models incorporating CrcB

  • Kinetic modeling: Simulate ion transport dynamics and cellular response

  • Agent-based modeling: Simulate cell behavior under environmental stressors

  • Boolean network modeling: Capture regulatory logic governing CrcB expression

• Visualization and Interpretation:

  • Multi-dimensional visualization techniques (PCA, t-SNE, UMAP)

  • Interactive visualization tools for exploring complex relationships

  • Pathway enrichment analysis to contextualize findings

  • Comparative analysis across related bacterial species

• Hypothesis Generation and Validation Loop:

  • Derive testable hypotheses from integrated data

  • Design targeted experiments to validate predictions

  • Refine model based on experimental outcomes

  • Iteratively improve model accuracy and predictive power

This systematic integration of diverse data types enables the development of a holistic model of CrcB homolog function in the context of H. chejuensis biology, environmental adaptation, and potential biotechnological applications.

What are the most promising future research directions for studying the CrcB homolog in H. chejuensis?

The exploration of the CrcB homolog in Hahella chejuensis presents several promising future research directions that could significantly advance our understanding of bacterial ion transport, environmental adaptation, and potential biotechnological applications. The most promising avenues include:

• Structural Biology Approaches: Determining the high-resolution structure of the CrcB homolog using cryo-electron microscopy or X-ray crystallography would provide critical insights into its ion selectivity and transport mechanism. Combining structural data with molecular dynamics simulations could reveal the precise ion permeation pathway and gating mechanisms.

• Systems Biology Integration: Developing comprehensive models that integrate the CrcB function within the broader cellular networks of H. chejuensis would enhance our understanding of how ion homeostasis influences various cellular processes, including secondary metabolite production. This approach would benefit from multi-omics data integration and network analysis.

• Ecological Role Investigation: Studying the role of the CrcB homolog in natural marine environments through metatranscriptomics and in situ gene expression analysis could reveal its importance in ecological adaptations and community interactions, particularly in the context of harmful algal bloom mitigation.

• Synthetic Biology Applications: Exploring the potential for engineering the CrcB homolog for enhanced ion transport or altered selectivity could lead to applications in bioremediation, biosensors, or synthetic cell design. This might include developing CrcB variants with enhanced fluoride export capabilities or altered ion selectivity.

• Comparative Genomics and Evolution: Investigating the evolutionary history of the CrcB homolog across marine bacteria would provide insights into adaptive selection pressures and functional diversification. This would help contextualize the specific adaptations present in the H. chejuensis variant.

These research directions, pursued with rigorous methodology and integrative approaches, would substantially advance our understanding of the CrcB homolog and its biological significance while potentially revealing novel applications in biotechnology and environmental management.

How can findings from CrcB homolog research contribute to broader understanding of marine bacterial adaptation and biotechnology?

Research on the CrcB homolog in Hahella chejuensis contributes to broader scientific understanding in multiple dimensions, with significant implications for both fundamental science and applied biotechnology:

• Marine Bacterial Adaptation Mechanisms: The study of CrcB homolog provides insights into how marine bacteria maintain ion homeostasis in variable ocean environments. This knowledge enhances our understanding of microbial adaptation to changing ocean conditions, including those resulting from climate change. The functional characterization of this protein illuminates specific molecular mechanisms underlying bacterial survival in marine ecosystems, contributing to ecological models of microbial community dynamics .

• Algal Bloom Control Strategies: Given H. chejuensis's role in producing algicidal compounds like prodigiosin, understanding the relationship between ion transport (via CrcB) and secondary metabolite production could inform new approaches to harmful algal bloom mitigation . This is particularly relevant as harmful algal blooms increasingly threaten marine environments, aquatic industries, and public health worldwide.

• Bioprospecting for Novel Bioactive Compounds: The genomic context of the CrcB homolog within H. chejuensis, a bacterium rich in secondary metabolite biosynthetic gene clusters, highlights its potential relevance to the discovery pipeline for new bioactive compounds . The demonstrated antimicrobial activity of some H. chejuensis metabolites suggests applications in drug discovery efforts.

• Membrane Protein Engineering: Insights from the structure-function relationships of the CrcB homolog could inform the design of engineered membrane proteins with novel properties for biotechnological applications. These might include biosensors, selective ion filters, or components of synthetic cells designed for specific environmental applications.

• Evolutionary Biology of Ion Channels: Comparative analysis of the CrcB homolog across bacterial species provides a window into the evolutionary development of ion transport mechanisms, contributing to our understanding of how fundamental cellular processes have evolved in response to environmental pressures.