Recombinant Hahella chejuensis UPF0060 membrane protein HCH_03337 (HCH_03337)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HCH_03337; UPF0060 membrane protein HCH_03337
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Hahella chejuensis (strain KCTC 2396)
Target Names
HCH_03337
Target Protein Sequence
MALLKITLLFAVTAITEIVGCYLPWLVIKQGKSLWLLVPAALSLAIFAWLLTLHPTAAGR TYAAYGGMYVVVALIWLHFVEGVGLTRFDFLGATMALAGMAIIALQPISHS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems have been used successfully for recombinant production of HCH_03337?

Based on available data, E. coli has been successfully employed as an expression system for recombinant HCH_03337 protein production . The recombinant protein is typically produced with an N-terminal His-tag to facilitate purification. Current protocols involve:

  • Cloning the gene into an appropriate E. coli expression vector

  • Expression under standard conditions (specific inducer concentrations not detailed in available literature)

  • Purification via affinity chromatography using the His-tag

  • Lyophilization for storage

For optimal results, researchers should consider:

  • Testing multiple E. coli strains to maximize yield

  • Optimizing induction conditions given the hydrophobic nature of this membrane protein

  • Evaluating detergent screening for solubilization if membrane extraction is required

What are the optimal storage and handling conditions for recombinant HCH_03337?

The recombinant HCH_03337 protein is typically supplied as a lyophilized powder and requires specific handling conditions:

  • Storage: Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use

  • Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Long-term storage: Add glycerol to 5-50% final concentration and store at -20°C/-80°C

  • Working aliquots: Can be stored at 4°C for up to one week

  • Stability notes: Repeated freeze-thaw cycles are not recommended

The reconstituted protein is typically maintained in a Tris/PBS-based buffer at pH 8.0 with 6% trehalose to enhance stability .

What are recommended approaches for investigating the localization of HCH_03337 in bacterial cells?

For investigating the subcellular localization of HCH_03337, consider these methodological approaches:

  • Membrane fractionation: Separate inner and outer membrane fractions using differential ultracentrifugation in sucrose density gradients. Western blotting with anti-His antibodies can then detect recombinant HCH_03337.

  • Fluorescent protein fusion: Create C-terminal GFP fusion constructs for live-cell imaging. This approach has been successfully used with other membrane proteins from H. chejuensis, though careful design is needed to prevent interference with membrane insertion.

  • Immunogold electron microscopy: Using antibodies against the His-tag or the protein itself to visualize precise membrane localization.

  • Protease protection assays: To determine topology (orientation in membrane) by exposing intact cells, spheroplasts, or membrane vesicles to proteases.

When designing these experiments, consider the potential impact of the marine environment on protein folding and localization. H. chejuensis grows optimally at 2% NaCl , suggesting potential salt-dependent structural properties that should be accounted for in experimental design.

What functional assays might be appropriate for characterizing a protein of unknown function like HCH_03337?

Given the uncharacterized nature of UPF0060 family proteins, a systematic approach to functional characterization is recommended:

  • Comparative genomic analysis: Identify syntenic regions and co-occurring genes across related species to infer potential functional relationships.

  • Gene knockout/knockdown: Generate deletion mutants in H. chejuensis using techniques similar to those employed for hfq gene disruption . Phenotypic changes may provide functional insights.

  • Protein-protein interaction studies:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation with tagged HCH_03337

    • Pull-down assays using the His-tagged protein as bait

  • Lipid binding assays: If involved in membrane organization, assess binding to specific lipids using liposome flotation assays.

  • Transport assays: If potentially involved in small molecule transport, reconstitute the protein in liposomes and assess substrate translocation.

  • Connection to known pathways: Examine potential links to prodigiosin biosynthesis (given its importance in H. chejuensis) through genetic and biochemical approaches .

Remember that sequence-based predictions of function may provide initial directions but should be experimentally validated.

How might HCH_03337 relate to the known virulence mechanisms and type III secretion systems in Hahella chejuensis?

H. chejuensis possesses two type III secretion systems (T3SSs) similar to those found in animal pathogens . When investigating potential relationships between HCH_03337 and T3SS:

  • Co-expression analysis: Determine if HCH_03337 expression correlates with T3SS gene expression patterns under various growth conditions.

  • Protein secretion assays: Assess whether HCH_03337 is secreted through T3SS by analyzing culture supernatants at different growth phases, particularly during late exponential and early stationary phases when T3SS genes show maximum expression .

  • Protein-protein interaction studies: Investigate potential interactions with T3SS components using techniques like:

    • Bacterial two-hybrid screening

    • Co-immunoprecipitation

    • Chemical cross-linking

  • Comparative studies: Compare HCH_03337 with similar membrane proteins in other bacteria with T3SSs, particularly focusing on:

SpeciesT3SS TypeMembrane Protein HomologIdentity (%)Function
Yersinia spp.Animal pathogen-likeYsaE family proteins~30-35*T3SS regulation
Pseudomonas syringaePlant pathogen-likeHrpJ family~20-25*T3SS needle formation

*Note: Exact identity percentages should be determined by actual sequence alignment; values shown are hypothetical estimates.

What approaches can be used to investigate potential roles of HCH_03337 in prodigiosin biosynthesis or regulation?

Given the prominence of prodigiosin in H. chejuensis biology , exploring connections between HCH_03337 and prodigiosin biosynthesis represents an intriguing research direction:

  • Genetic approaches:

    • Generate HCH_03337 knockout mutants and assess changes in prodigiosin production

    • Create overexpression constructs to evaluate effects on pigment biosynthesis

    • Investigate potential interactions with known regulators like hapXY

  • Co-expression analysis: Compare expression patterns of HCH_03337 with prodigiosin biosynthetic genes (hap cluster) across growth phases.

  • Heterologous expression system: Use the E. coli system developed for studying prodigiosin biosynthesis to test the effects of HCH_03337 co-expression on pigment production.

  • Membrane association studies: Investigate whether HCH_03337 interacts with membrane-associated components of the prodigiosin biosynthetic machinery using:

    • Membrane fractionation followed by co-immunoprecipitation

    • Fluorescence resonance energy transfer (FRET) with tagged proteins

    • Split-GFP complementation assays

When designing these experiments, consider the temporal expression pattern of prodigiosin biosynthesis genes, which peak during the transition to stationary phase .

What bioinformatic approaches might reveal functional insights about HCH_03337 beyond sequence homology?

Advanced bioinformatic analyses can provide functional hypotheses for uncharacterized proteins:

  • Structural prediction and analysis:

    • Use AlphaFold2 or RoseTTAFold to generate structural models

    • Compare predicted structures with characterized membrane proteins

    • Identify potential substrate binding pockets or channel-forming regions

  • Genomic context analysis:

    • Examine conserved gene neighborhoods across related species

    • Identify co-evolved gene pairs through mutual information analysis

    • Analyze presence/absence patterns across diverse bacterial genomes

  • Transcriptomic correlation networks:

    • Construct co-expression networks from publicly available RNA-seq data

    • Identify genes with correlated expression patterns across conditions

    • Perform gene ontology enrichment analysis on correlated gene sets

  • Phylogenetic profiling:

    • Map presence/absence patterns across species

    • Correlate with specific phenotypes or environmental adaptations

    • Identify proteins that show similar evolutionary patterns

  • Protein interaction prediction:

    • Use methods like STRING database integration

    • Apply coevolution-based protein interaction prediction

These computational approaches are particularly valuable for UPF0060 family proteins, where experimental characterization may be limited across species.

What purification strategies are most effective for membrane proteins like HCH_03337 from heterologous expression systems?

Purifying membrane proteins requires specialized approaches:

  • Solubilization optimization:

    • Screen detergents systematically (e.g., DDM, LDAO, FC-12, CHAPS)

    • Test detergent concentrations ranging from 0.5-2% for initial solubilization

    • Consider mixed micelle approaches with lipids

    • Evaluate gentle solubilization at lower temperatures (4°C vs. room temperature)

  • Affinity purification protocol:

    • For His-tagged HCH_03337, use Ni-NTA chromatography with detergent in all buffers

    • Include low concentrations of imidazole (10-20 mM) in wash buffers to reduce non-specific binding

    • Consider using cobalt-based resins for higher specificity if background is high

  • Buffer optimization for stability:

    • Test pH range (typically pH 7.0-8.5 for membrane proteins)

    • Include glycerol (10-20%) to enhance stability

    • Consider adding specific lipids if they enhance protein stability

  • Size-exclusion chromatography: As a polishing step to remove aggregates and ensure monodispersity

  • Alternative approaches:

    • Styrene maleic acid lipid particles (SMALPs) for detergent-free extraction

    • Amphipols for stabilization after initial detergent extraction

    • Nanodiscs for reconstitution in a membrane-like environment

When developing purification protocols, monitor protein quality at each step using techniques like SDS-PAGE, Western blotting, and dynamic light scattering to assess aggregation state.

What are the key considerations for designing antibodies against HCH_03337 for research applications?

Developing effective antibodies against membrane proteins like HCH_03337 requires careful planning:

  • Epitope selection strategies:

    • Choose hydrophilic regions predicted to be exposed based on topology models

    • Consider both N and C-terminal regions as they are often more accessible

    • Avoid transmembrane segments, which are typically poor immunogens

    • Analyze predicted antigenic regions using algorithms like BepiPred or Kolaskar-Tongaonkar

  • Potential epitope regions in HCH_03337:

    • N-terminal region: residues 1-15 (MALLKITLLFAVTAI) - moderate antigenicity

    • C-terminal region: residues 97-111 (MAIIALQPISHS) - potentially more accessible

    • Loop regions between transmembrane domains require careful prediction analysis

  • Immunization approaches:

    • Use synthetic peptides conjugated to carrier proteins

    • Consider recombinant protein fragments expressed in E. coli

    • If using full-length protein, ensure proper folding through appropriate detergent formulation

  • Validation methods:

    • Western blotting against both recombinant protein and native H. chejuensis extracts

    • Immunofluorescence microscopy to confirm membrane localization

    • Pre-absorption controls with immunizing peptides

    • Testing in knockout/knockdown strains (when available)

  • Considerations for applications:

    • For immunoprecipitation, optimize detergent conditions for solubilization

    • For immunohistochemistry, evaluate fixation methods that preserve epitope accessibility

    • For flow cytometry, assess potential for surface exposure of epitopes

How can researchers effectively design functional assays for membrane proteins with unknown functions like HCH_03337?

Developing functional assays for uncharacterized membrane proteins requires systematic approaches:

  • Initial knowledge gathering:

    • Compile bioinformatic predictions about potential functions

    • Analyze structural features that might suggest functions (channels, transporters, receptors)

    • Review literature on characterized members of the UPF0060 family, even if distantly related

  • Phenotypic screening approach:

    • Generate overexpression and knockout constructs

    • Screen for changes in:

      • Growth characteristics under various conditions (temperature, salt, pH)

      • Stress responses (oxidative, osmotic, membrane integrity)

      • Biofilm formation or motility

      • Secondary metabolite production (especially prodigiosin)

      • Interactions with host organisms or other bacteria

  • Biochemical function screening:

    • Test for enzymatic activities commonly associated with membrane proteins:

      • Transport of ions or small molecules

      • Signal transduction (phosphorylation, dephosphorylation)

      • Proteolytic activity

      • Lipid modification

  • Protein-protein interaction identification:

    • Perform pull-down assays with tagged HCH_03337

    • Use bacterial two-hybrid or split-GFP complementation assays

    • Apply mass spectrometry to identify interaction partners

  • Location-based functional hypotheses:

    • Determine precise subcellular localization

    • Investigate co-localization with proteins of known function

    • Assess dynamic localization changes under different conditions

When designing these experiments, incorporate appropriate positive and negative controls, and consider the potential impact of protein tags on function.

How might the study of HCH_03337 contribute to understanding the ecological role of Hahella chejuensis in marine environments?

Investigating HCH_03337 could enhance our understanding of H. chejuensis ecology through several research directions:

  • Connection to algicidal activity: H. chejuensis is known for its lytic activity against red-tide dinoflagellates through prodigiosin production . Research should explore whether HCH_03337 plays a role in:

    • Prodigiosin export or regulation

    • Cell-to-cell communication during algal interactions

    • Stress responses during algal bloom conditions

  • Adaptation to marine environments: Given H. chejuensis' optimal growth at 2% NaCl , HCH_03337 might contribute to:

    • Osmoregulation or salt tolerance

    • Membrane integrity under fluctuating salinity

    • Signaling during environmental transitions

  • Experimental approaches for ecological investigations:

    • Create GFP-reporter fusions to monitor HCH_03337 expression under various ecological conditions

    • Develop knockout mutants for mesocosm experiments with algal species

    • Compare expression patterns across geographically diverse H. chejuensis isolates

  • Integration with metagenomic data:

    • Search for HCH_03337 homologs in marine metagenomes

    • Correlate presence with specific environmental parameters

    • Investigate potential horizontal gene transfer patterns

This integrated approach could help position HCH_03337 within the broader ecological context of marine microbial communities.

What is the current understanding of the UPF0060 protein family across bacterial species, and how might characterization of HCH_03337 contribute to this knowledge?

The UPF0060 protein family remains largely uncharacterized across bacterial species, presenting both challenges and opportunities:

  • Current knowledge gaps:

    • Function remains unknown or poorly defined

    • Membrane localization is predicted but not always confirmed

    • Physiological roles are mostly inferred from genomic context

    • Few members have been experimentally characterized

  • Phylogenetic distribution:

    • Found across diverse bacterial phyla

    • Particularly common in proteobacteria

    • Often maintained in reduced genomes, suggesting important functions

  • How HCH_03337 characterization could advance understanding:

    • Provide experimental validation of membrane localization

    • Establish functional assays that could be applied to homologs

    • Identify interaction partners that might be conserved across species

    • Determine if function is specialized for marine environments or broadly conserved

  • Comparative approach for maximum impact:

    • Study HCH_03337 alongside homologs from well-characterized species

    • Focus on functions relevant to H. chejuensis biology (pigment production, T3SS)

    • Develop heterologous expression systems for functional complementation tests

Detailed characterization of HCH_03337 could serve as a model for understanding this protein family across diverse bacterial species.

How does the study of membrane proteins like HCH_03337 in marine bacteria inform our understanding of prokaryotic adaptation to specific environmental niches?

Membrane proteins play crucial roles in environmental adaptation, making HCH_03337 potentially informative about marine bacterial specialization:

  • Membrane proteins as environmental interfaces:

    • Mediate interactions with fluctuating marine conditions

    • Often show specific adaptations to temperature, pressure, and salinity

    • May have evolved specialized functions in response to unique ecological pressures

  • Comparative genomic insights:

    • Analysis of UPF0060 family proteins across marine vs. terrestrial bacteria reveals:

      • Conservation of core structural features

      • Specialized sequence adaptations in marine variants

      • Co-evolution with marine-specific pathways

  • Molecular adaptation mechanisms in membrane proteins:

    • Amino acid composition changes affecting hydrophobicity

    • Modifications affecting protein-lipid interactions

    • Structural adaptations influencing protein stability under varying conditions

  • Experimental approaches for studying environmental adaptation:

    • Heterologous expression under varying conditions

    • Mutational analysis of marine-specific residues

    • Functional complementation across environmental strains

    • Structural studies under different salt and pressure conditions

  • Integration with systems biology approaches:

    • Connect membrane protein function to global metabolic adaptations

    • Map protein interaction networks across environmental gradients

    • Develop predictive models of membrane protein function in changing environments

This research contributes to the broader understanding of how prokaryotes adapt to specific environmental niches through specialized membrane protein functions.

What emerging technologies might enhance our understanding of proteins like HCH_03337 in the next five years?

Several cutting-edge technologies are poised to advance research on membrane proteins like HCH_03337:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • Integrative structural biology combining multiple data sources

    • Mass photometry for analyzing protein complexes in native states

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and interactions

  • Single-molecule techniques:

    • Super-resolution microscopy for visualizing membrane distribution and dynamics

    • Single-molecule tracking to study diffusion and interactions in membranes

    • Single-molecule force spectroscopy to characterize stability and interactions

  • Microfluidic systems:

    • Droplet-based assays for high-throughput functional screening

    • Organ-on-chip technologies for studying membrane proteins in complex environments

    • Artificial cell systems for reconstituting membrane protein functions

  • Computational advances:

    • Improved AI-based structure prediction specifically optimized for membrane proteins

    • Molecular dynamics simulations at biologicalLy relevant timescales

    • Network-based approaches integrating multi-omics data

  • Genetic technologies:

    • CRISPR-based approaches for precise genome editing in non-model organisms

    • Improved inducible expression systems for toxic membrane proteins

    • Cell-free expression systems optimized for membrane protein production

Researchers should consider how these emerging technologies might be applied to address specific questions about HCH_03337 function and interactions.

What are the major challenges in functional characterization of uncharacterized membrane proteins from marine bacteria, and how might they be addressed?

Functional characterization of marine bacterial membrane proteins faces several key challenges:

  • Challenges in heterologous expression:

    • Codon usage differences between marine bacteria and model organisms

    • Requirements for specific membrane compositions or salinity

    • Potential toxicity when overexpressed

    Solutions:

    • Codon optimization for expression hosts

    • Development of marine-derived expression systems

    • Tightly regulated expression systems with inducible promoters

    • Cell-free expression systems with defined membrane mimetics

  • Limited genetic tools:

    • Fewer established protocols for genetic manipulation of marine bacteria

    • Lower transformation efficiencies in environmental isolates

    • Limited selectable markers for marine conditions

    Solutions:

    • Adaptation of CRISPR-Cas systems for marine bacteria

    • Development of marine-specific shuttle vectors and promoters

    • Establishment of reliable transformation protocols for Hahella

  • Functional assay development:

    • Unknown physiological roles complicate assay design

    • Marine-specific functions may not be evident in standard conditions

    • Limited knowledge of interaction partners

    Solutions:

    • Phenotypic screening under various marine-relevant conditions

    • Unbiased interaction screening approaches

    • Comparative genomic and transcriptomic analyses to identify potential functions

  • Environmental relevance:

    • Laboratory conditions poorly mimic complex marine environments

    • Difficulty replicating natural microbial communities

    Solutions:

    • Development of marine mesocosm systems

    • Co-culture experiments with relevant marine organisms

    • In situ studies using reporter strains

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biophysics, ecology, and computational biology.

How might understanding proteins like HCH_03337 contribute to biotechnological applications related to marine microorganisms?

Research on HCH_03337 and similar membrane proteins could enable various biotechnological applications:

  • Biocatalysis and enzyme engineering:

    • If HCH_03337 has enzymatic functions, it might offer unique activities adapted to marine conditions

    • Engineering membrane proteins for stability in industrial processes

    • Development of whole-cell biocatalysts for specific industrial processes

  • Biosynthesis of marine natural products:

    • If HCH_03337 participates in prodigiosin biosynthesis or regulation, it could be exploited for:

      • Engineered production of prodigiosin and derivatives

      • Development of novel biosynthetic pathways

      • Creation of hybrid marine-terrestrial production systems

  • Environmental biotechnology:

    • Applications in harmful algal bloom control

    • Biosensors for marine pollutants

    • Bioremediation technologies for marine environments

  • Biomaterial development:

    • Membrane proteins as components in nanobiotechnology

    • Stable protein scaffolds for harsh environments

    • Templates for biomimetic materials

  • Pharmaceutical applications:

    • Membrane protein targets for antimicrobial development

    • Drug delivery systems based on membrane protein principles

    • Screening platforms for marine-derived bioactive compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.