Recombinant Halichoerus grypus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol includes 50% glycerol; however, customers are free to adjust this concentration as needed.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development of that tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Halichoerus grypus (Gray seal)
Target Names
Target Protein Sequence
MNENLFASFTTPTMMGLPIVILIVLFPSILFPSPDRLINNRLTSIQQWLIQLTSKQMLSI HNHKGQTWALMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHK TKASLAHFLPQGTPLPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA LMDISTTTAFITFIVLILLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for ATP production from ADP in the presence of a proton gradient across the membrane. This gradient is generated by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked via a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism of the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Halichoerus grypus ATP synthase subunit a (MT-ATP6) and what is its function?

Recombinant Halichoerus grypus ATP synthase subunit a (MT-ATP6) is a protein derived from gray seal mitochondria that forms a critical component of ATP synthase (Complex V). The MT-ATP6 protein constitutes one essential subunit of the ATP synthase enzyme, which is responsible for the final step of oxidative phosphorylation. This protein facilitates the flow of protons across the inner mitochondrial membrane, creating an electrochemical gradient that drives the conversion of adenosine diphosphate (ADP) to adenosine triphosphate (ATP), the cell's primary energy source .

The full-length protein consists of 226 amino acid residues with the sequence beginning with MNENLFAST and ending with YLHDNT. Its recommended name is ATP synthase subunit a, with the alternative designation F-ATPase protein 6 .

What are the optimal storage conditions for Recombinant Halichoerus grypus MT-ATP6?

For optimal preservation of protein structure and function, Recombinant Halichoerus grypus MT-ATP6 should be stored in a Tris-based buffer containing 50% glycerol. The protein should be kept at -20°C for regular storage, and at -20°C or -80°C for extended preservation. It is critical to avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity and activity. For ongoing experiments, working aliquots can be maintained at 4°C but should be used within one week to ensure optimal activity .

How does MT-ATP6 from Halichoerus grypus compare to human MT-ATP6 in functional studies?

While the search results don't provide direct comparisons between Halichoerus grypus and human MT-ATP6, we can infer some comparisons based on their evolutionary conservation and functional roles. Both proteins serve as subunits of ATP synthase (Complex V) and are encoded by mitochondrial DNA. The human MT-ATP6 protein forms a critical component of the membrane-embedded F0 portion of ATP synthase that facilitates proton flow across the inner mitochondrial membrane .

Human ATP synthase has been more extensively studied, particularly in the context of pathogenic variants. Studies have shown that mutations in human MT-ATP6 can lead to diverse clinical syndromes including Leigh syndrome and neuropathy ataxia retinitis pigmentosa . The recombinant Halichoerus grypus protein provides researchers with a comparative model to study evolutionary conservation of ATP synthase function across mammalian species.

What are the recommended protocols for using Recombinant Halichoerus grypus MT-ATP6 in ELISA-based experiments?

When designing ELISA experiments with Recombinant Halichoerus grypus MT-ATP6, researchers should consider the following methodological approach:

  • Protein Preparation: Use the recombinant protein directly from storage by allowing it to thaw on ice. Avoid repeated freeze-thaw cycles by preparing single-use aliquots.

  • Coating Conditions: For optimal adsorption to ELISA plates, dilute the protein in carbonate-bicarbonate buffer (pH 9.6) to a concentration of 1-10 μg/ml, depending on specific experimental requirements.

  • Blocking: After coating, block non-specific binding sites with 1-5% BSA or 1-5% non-fat dry milk in PBS-T (PBS with 0.05% Tween-20).

  • Detection Optimization: If the protein has been tagged during production (as indicated in search result ), consider using tag-specific antibodies for detection or capture, depending on the ELISA format.

  • Controls: Include appropriate positive and negative controls to validate assay specificity, particularly when testing for cross-reactivity with other ATP synthase subunits .

What biochemical assays are recommended for evaluating MT-ATP6 functionality in research settings?

Based on studies of MT-ATP6 variants, several biochemical assays have been established to assess functional characteristics:

  • ATP Synthesis Rate Measurement: This key assay directly measures the protein's primary function. Methodologically, isolated mitochondria or submitochondrial particles containing the MT-ATP6 protein are exposed to ADP and inorganic phosphate, and the rate of ATP production is quantified using luciferase-based luminescence assays or HPLC-based methods .

  • ATP Hydrolysis Assessment: While MT-ATP6 is primarily involved in ATP synthesis, measuring ATP hydrolysis can provide insights into the bidirectional functionality of ATP synthase. This is typically measured by quantifying inorganic phosphate release from ATP .

  • Mitochondrial Membrane Potential Analysis: As MT-ATP6 is involved in proton translocation across the inner mitochondrial membrane, measuring membrane potential using fluorescent dyes like JC-1 or TMRM provides indirect evidence of MT-ATP6 function .

  • Proton Translocation Assays: These specialized assays measure the ability of ATP synthase to transport protons across membranes, often using pH-sensitive fluorescent probes in reconstituted liposome systems.

The most common findings in pathogenic MT-ATP6 variants include reduced ATP synthesis rate, preserved ATP hydrolysis capacity, and abnormally increased mitochondrial membrane potential, though no single biochemical feature is universally observed across all variants .

How can researchers differentiate between pathogenic and non-pathogenic variants in recombinant MT-ATP6 studies?

Determining the pathogenicity of MT-ATP6 variants requires a comprehensive approach:

  • Heteroplasmy Assessment: Quantify the proportion of mutant mtDNA using techniques such as quantitative pyrosequencing or fluorescent restriction fragment length polymorphism analysis. Research indicates that symptomatic subjects typically have significantly higher heteroplasmy loads compared to asymptomatic carriers (p=1.6×10^-39) .

  • Functional Biochemical Testing: Conduct multiple biochemical assays as pathogenic variants often show:

    • Decreased ATP synthesis rates (observed in 36 out of 38 cases for m.8993T>G variant)

    • Normal or slightly reduced ATP hydrolysis capacity

    • Abnormally elevated mitochondrial membrane potential

    • Variably affected electron transport chain complex functions

  • Tissue-Specific Effects Analysis: Investigate variant effects across different tissue types, as research has demonstrated that tissue segregation patterns are variant-dependent .

  • Threshold Effect Evaluation: Determine the heteroplasmy threshold at which biochemical defects manifest, as this threshold varies between different pathogenic variants .

  • Maternal Inheritance Pattern: Confirm maternal transmission pattern through multi-generational analysis when possible .

It's important to note that no single biochemical feature is universally present in all pathogenic variants, necessitating a multi-parameter approach to variant classification .

What are the key considerations when designing experiments to study the interaction between MT-ATP6 and other ATP synthase subunits?

When investigating interactions between Recombinant Halichoerus grypus MT-ATP6 and other ATP synthase subunits, researchers should consider:

  • Membrane Environment Reconstitution: MT-ATP6 is a hydrophobic, membrane-embedded protein that requires appropriate lipid environments for native folding and function. Experiments should include reconstitution in liposomes or nanodiscs with lipid compositions mimicking the inner mitochondrial membrane.

  • Proximity Labeling Approaches: Techniques such as BioID or APEX2 proximity labeling can identify interacting partners in near-native conditions.

  • Co-immunoprecipitation Optimization: When performing co-IP studies, use mild detergents (such as digitonin or DDM) for solubilization to preserve protein-protein interactions. Consider crosslinking approaches to capture transient interactions.

  • Cryo-EM Analysis: For structural studies, cryo-electron microscopy has proven valuable for resolving interactions between ATP synthase subunits at near-atomic resolution.

  • FRET-Based Interaction Studies: Förster resonance energy transfer approaches using fluorescently-labeled subunits can provide insights into spatial relationships and conformational changes.

  • Comparative Analysis: Include comparative studies with ATP synthase subunits from other species, particularly human ATP5F1B, which has been well-characterized and shown to adopt different conformations (βDP, βTP, or βE) during the catalytic cycle .

How should researchers address the heterogeneity in MT-ATP6 variant biochemical phenotypes when designing control experiments?

The extensive heterogeneity in both clinical and biochemical features associated with MT-ATP6 variants presents significant challenges for experimental design. Researchers should implement the following strategies:

  • Multiple Biochemical Endpoint Assessment: Design experiments that measure multiple parameters simultaneously (ATP synthesis, hydrolysis, membrane potential) rather than relying on a single biochemical readout. Research has demonstrated that no single biochemical feature is universally observed across pathogenic variants .

  • Heteroplasmy-Matched Controls: When studying MT-ATP6 variants, control samples should be matched for heteroplasmy levels whenever possible, as research has shown significant overlap in heteroplasmy levels between symptomatic and asymptomatic individuals .

  • Tissue-Specific Controls: Different tissues show variable sensitivity to MT-ATP6 variants. Include tissue-matched controls and consider testing multiple tissue types when feasible, as tissue segregation patterns appear to be variant-dependent .

  • Threshold Determination: For each variant studied, establish the heteroplasmy threshold at which biochemical defects become apparent. This threshold varies between variants and provides crucial context for experimental interpretation .

  • Statistical Power Considerations: Due to biochemical heterogeneity, larger sample sizes may be required to detect statistically significant differences between experimental and control groups.

What methodological approaches can address challenges in determining the pathogenicity of novel MT-ATP6 variants?

Determining the pathogenicity of novel MT-ATP6 variants remains challenging due to the lack of clinically-available functional assays. Researchers can implement the following methodological approaches:

  • Comprehensive Biochemical Profiling: Assess multiple parameters including:

    • ATP synthesis rate using luciferase-based assays

    • ATP hydrolysis capacity

    • Mitochondrial membrane potential measurements

    • Electron transport chain complex function

  • Heteroplasmy Quantification: Employ sensitive techniques like quantitative pyrosequencing or fluorescent restriction fragment length polymorphism analysis to accurately measure heteroplasmy levels down to 3% .

  • In Silico Prediction Models: Utilize computational tools that incorporate evolutionary conservation, structural impact, and known biochemical effects of similar variants.

  • Cybrid Cell Models: Create transmitochondrial cybrid cell lines containing the variant of interest at different heteroplasmy levels to assess dose-dependent biochemical effects.

  • Family Studies: When possible, conduct maternal lineage analyses to assess inheritance patterns and penetrance.

  • Correlation with Clinical Data: Compare biochemical findings with detailed neurological and clinical evaluations rather than relying on simple syndromic classifications .

This multi-faceted approach increases confidence in pathogenicity assessments and helps overcome the limitations of any single method, which is particularly important given that even among established pathogenic variants, there is considerable heterogeneity in biochemical phenotypes .

How does the use of Recombinant Halichoerus grypus MT-ATP6 compare with other species' MT-ATP6 proteins in mitochondrial research?

While the search results don't provide direct comparative data between different species' MT-ATP6 proteins, researchers can consider the following methodological approaches when conducting comparative studies:

  • Evolutionary Conservation Analysis: Compare sequence homology and structural conservation between Gray seal MT-ATP6 and other mammalian species. The high conservation of functional domains can provide insights into critical regions for ATP synthase function.

  • Species-Specific Adaptations: Investigate unique adaptations in Gray seal MT-ATP6 that might relate to their marine lifestyle, particularly adaptations related to oxygen utilization efficiency and mitochondrial function under diving conditions.

  • Comparative Biochemistry: When designing experiments, include parallel assays with MT-ATP6 from multiple species (particularly human MT-ATP6) to establish whether findings are species-specific or represent conserved features of mitochondrial function.

  • Variable Domain Functional Analysis: Create chimeric proteins containing domains from different species' MT-ATP6 to identify functionally critical regions and species-specific adaptations.

  • Environmental Adaptability Studies: Compare how MT-ATP6 from different species responds to varying experimental conditions (temperature, pH, oxygen levels) to understand environmental adaptations at the molecular level.

These comparative approaches can provide valuable insights into both fundamental ATP synthase function and species-specific adaptations in energy metabolism.

What are the key differences in experimental design when studying MT-ATP6 from Halichoerus grypus compared to human MT-ATP6 in disease models?

When adapting experimental protocols from human MT-ATP6 disease models to studies using Recombinant Halichoerus grypus MT-ATP6, researchers should consider several methodological modifications:

  • Heteroplasmy Considerations: Human MT-ATP6 disease studies focus significantly on heteroplasmy thresholds and tissue distribution of pathogenic variants. When using Gray seal MT-ATP6, researchers may need to artificially introduce variant mixtures to model heteroplasmy effects .

  • Temperature Optimization: Adjust experimental temperatures based on the physiological temperature range of Gray seals, which is generally lower than human body temperature. This is particularly important for enzyme kinetic studies.

  • Oxygen Utilization Parameters: Gray seals have evolved adaptations for extended diving and oxygen utilization efficiency. Experimental oxygen conditions may need adjustment when comparing to human mitochondrial function models.

  • Biochemical Reference Ranges: Establish Gray seal-specific reference ranges for ATP synthesis rates, membrane potential, and other biochemical parameters rather than applying human-derived normal ranges.

  • Pathogenic Variant Selection: When modeling disease-associated variants, prioritize those occurring in highly conserved regions between human and Gray seal MT-ATP6 to ensure biological relevance.

  • Tissue-Specific Effects: Human studies have demonstrated variant-dependent tissue segregation patterns. When modeling with Gray seal MT-ATP6, consider potential differences in tissue-specific expression and effects .

By carefully addressing these methodological differences, researchers can develop more accurate models while leveraging the comparative advantages of studying MT-ATP6 across different species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.