Recombinant Halichoerus grypus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Function

MT-ND3 is a mitochondrially encoded subunit of NADH dehydrogenase (Complex I), the first enzyme in the electron transport chain. It plays a critical role in:

  • Electron transfer: Mediating electron transport from NADH to ubiquinone .

  • Proton pumping: Contributing to the conformational changes required for proton translocation across the mitochondrial inner membrane .

  • Structural integrity: Acting as a core component of Complex I’s transmembrane domain, stabilizing its hydrophobic core .

In Halichoerus grypus, recombinant MT-ND3 retains these conserved functions but may exhibit species-specific adaptations in residue composition or post-translational modifications.

Production and Characterization

Recombinant MT-ND3 is typically generated using heterologous expression systems (e.g., E. coli or yeast) with codon optimization for nuclear expression. Key steps include:

ParameterDetails
Gene SourceMitochondrial DNA of Halichoerus grypus (grey seal)
Expression SystemCodon-optimized nuclear expression for cytoplasmic translation
Targeting MechanismMitochondrial import via N-terminal targeting sequences
Functional ValidationRestoration of Complex I activity in MT-ND3-deficient cell lines

Research Applications

Recombinant MT-ND3 enables:

  • Disease modeling: Studying mitochondrial disorders like Leigh syndrome .

  • Therapeutic development: Testing allotopic expression to rescue Complex I defects .

  • Structural studies: Cryo-EM or crystallography to map proton pathways (e.g., PDB 4WZ7 for human Complex I) .

Future Directions

  • Species-specific adaptations: Investigate functional differences between seal and human MT-ND3.

  • High-throughput screening: Use recombinant protein to identify small-molecule modulators of Complex I.

  • Gene therapy: Optimize codon-usage frameworks for mitochondrial delivery .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Halichoerus grypus (Gray seal)
Target Names
Target Protein Sequence
MNMALTLFTNTALASLLVLIAFWLPQLNTYSEKVSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASHTDNLTTMLTMALLLISLLAASLAYEWTEKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is crucial for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MT-ND3 in mitochondrial respiration?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is an essential component of mitochondrial complex I, which forms the first enzyme in the electron transport chain of oxidative phosphorylation. This protein plays a critical role in transferring electrons from NADH to ubiquinone, contributing to the proton gradient necessary for ATP synthesis. In marine mammals like Halichoerus grypus, MT-ND3 may exhibit specialized adaptations for deep-diving hypoxic conditions, potentially involving modified electron transport efficiency during oxygen limitation periods . The protein functions within the membrane domain of complex I, anchoring the complex to the inner mitochondrial membrane and participating in proton translocation.

How should recombinant MT-ND3 protein be stored to maintain functionality?

Recombinant MT-ND3 protein should be stored at -20°C/-80°C upon receipt, with aliquoting being necessary for multiple use. The protein typically arrives as a lyophilized powder that should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% before aliquoting and storing at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can significantly reduce protein stability and activity . Before opening, vials should be briefly centrifuged to bring contents to the bottom.

What expression systems are optimal for recombinant Halichoerus grypus MT-ND3 production?

Based on similar mitochondrial proteins, E. coli is an effective host for recombinant MT-ND3 production from marine mammals . For Halichoerus grypus MT-ND3 specifically, BL21(DE3) or Rosetta(DE3) strains are recommended due to their reduced protease activity and ability to express proteins containing rare codons that might be present in marine mammal sequences. Expression should be optimized using various IPTG concentrations (0.1-1.0 mM) and induction temperatures (16-30°C), with lower temperatures often improving protein solubility. Addition of N-terminal His-tags facilitates purification while maintaining protein functionality . For membrane proteins like MT-ND3, specialized detergents such as n-dodecyl β-D-maltoside (DDM) at 0.1-1% should be incorporated in lysis and purification buffers to enhance solubility.

What are the typical yields and purity levels expected from recombinant MT-ND3 expression?

Standard recombinant expression of MT-ND3 typically yields protein with greater than 90% purity as determined by SDS-PAGE analysis . Expected yields vary based on expression conditions, but generally range from 2-5 mg/L of bacterial culture. Purity can be verified using SDS-PAGE, with recombinant MT-ND3 appearing at approximately 13-15 kDa (considering the protein length of 116-148 amino acids plus the His-tag) . Western blot analysis using anti-His antibodies provides additional confirmation of target protein expression and purity. Higher yields may be achieved by optimizing codon usage for E. coli and employing specialized expression vectors designed for membrane proteins.

How can variants in Halichoerus grypus MT-ND3 be functionally characterized to understand their impact on mitochondrial complex I activity?

Functional characterization of Halichoerus grypus MT-ND3 variants requires a multi-parametric approach:

A comprehensive analysis would include comparison with wild-type MT-ND3 and known pathogenic variants to establish a functional significance scale .

What strategies can be employed for allotopic expression of codon-optimized MT-ND3 to rescue mitochondrial defects in cell models?

Allotopic expression of MT-ND3 can be achieved through these methodological approaches:

  • Codon optimization: The mitochondrial genetic code differs from the nuclear code, so MT-ND3 sequences must be recoded using nuclear genetic code. Additionally, codon usage should be optimized for efficient cytoplasmic translation .

  • Mitochondrial targeting sequence (MTS) design: An effective MTS (typically 20-40 amino acids) from nuclear-encoded mitochondrial proteins (e.g., COX8, ATP5G1) should be fused to the N-terminus of the recoded MT-ND3 .

  • Vector selection: Lentiviral or AAV vectors provide stable, long-term expression for cell models. Inducible promoters (e.g., Tet-On systems) allow controlled expression levels.

  • Import verification: Successful import can be confirmed by fractionation studies and western blotting, immunocytochemistry with confocal microscopy, or by creating fusion proteins with fluorescent tags.

  • Functional rescue assessment: Restoration of complex I assembly can be measured by Blue Native-PAGE, while functional rescue can be evaluated through ATP synthesis assays, which should show significant improvement compared to untreated cells .

This approach has demonstrated efficacy in partially restoring protein levels, complex I activity, and ATP production in cells with MT-ND3 variants .

How does the amino acid sequence of Halichoerus grypus MT-ND3 compare to other marine mammals, and what structural implications do these differences have?

While specific sequence data for Halichoerus grypus MT-ND3 is not provided in the search results, comparative analysis can be approached through:

  • Sequence alignment methodology: Multiple sequence alignment tools like MUSCLE or CLUSTAL should be used to compare MT-ND3 sequences across marine mammals, terrestrial mammals, and other vertebrates.

  • Conservation analysis: Key structural regions, including transmembrane domains and functional motifs, should be identified through conservation scoring.

  • Adaptation signatures: Positive selection analysis using PAML or HyPhy can identify amino acid positions under adaptive selection in marine mammals, potentially reflecting diving adaptations.

  • Structural prediction: Homology modeling based on available complex I structures (like those from mammalian or bacterial sources) can provide insights into how sequence variations might affect protein folding and interactions.

  • Functional domain analysis: Special attention should be paid to residues interacting with other complex I subunits or involved in proton pumping.

Based on other MT-ND3 sequences, the protein typically contains 115-148 amino acids with multiple transmembrane domains . Marine mammals often show adaptations in mitochondrial proteins related to oxygen utilization efficiency and ROS management, which may be reflected in specific substitutions in MT-ND3.

What experimental approaches can detect protein-protein interactions between MT-ND3 and other complex I components in a research setting?

Investigating protein-protein interactions involving MT-ND3 requires specialized approaches due to its hydrophobic nature and mitochondrial localization:

  • Chemical cross-linking mass spectrometry (XL-MS): This technique captures transient interactions by covalently linking proteins in close proximity before digestion and mass spectrometric analysis. For MT-ND3, membrane-permeable crosslinkers like DSS or formaldehyde are recommended.

  • Co-immunoprecipitation with mild detergents: Using antibodies against tagged MT-ND3 or potential interacting partners, coupled with gentle solubilization using digitonin (0.5-1%) or DDM (0.1-0.5%), can preserve physiologically relevant interactions.

  • Proximity labeling techniques: BioID or APEX2 fused to MT-ND3 can biotinylate proteins in close proximity, which are then identified by streptavidin pulldown and mass spectrometry.

  • Förster Resonance Energy Transfer (FRET): For live-cell dynamics, MT-ND3 and potential interaction partners can be tagged with appropriate fluorophores to measure energy transfer as an indicator of protein proximity.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique identifies protein interaction surfaces by measuring the rate of hydrogen-deuterium exchange, which is altered at protein-protein interfaces.

The data obtained should be validated through multiple approaches and compared with known complex I structural data from cryo-EM studies to confirm biological relevance.

What are the optimal buffer conditions for maintaining MT-ND3 stability during purification and functional studies?

The optimal buffer conditions for MT-ND3 protein stability include:

Buffer ComponentRecommended RangeFunction
Buffer BaseTris or PBS, pH 7.5-8.0Maintains physiological pH
Detergent0.1-0.5% DDM or 0.5-1% digitoninSolubilizes membrane protein
Salt100-250 mM NaClReduces non-specific interactions
Stabilizing Agent5-10% glycerol or 6% trehalosePrevents protein aggregation
Reducing Agent1-5 mM DTT or 1-2 mM β-mercaptoethanolMaintains thiol groups
Protease InhibitorsComplete EDTA-free cocktailPrevents degradation

For long-term storage, addition of trehalose (6%) provides cryoprotection and maintains protein stability . During functional assays, the buffer should be supplemented with substrates specific to complex I function, including 100-200 μM NADH and 50-100 μM ubiquinone analogs (e.g., decylubiquinone). The presence of phospholipids (0.1-0.5 mg/ml) such as cardiolipin may further enhance stability and activity of the membrane protein.

How can researchers troubleshoot low expression yields of recombinant Halichoerus grypus MT-ND3?

When facing low expression yields of recombinant MT-ND3, researchers should implement this systematic troubleshooting approach:

  • Codon optimization: Marine mammal sequences may contain codons rarely used in E. coli. Synthesize a codon-optimized gene sequence for E. coli expression.

  • Expression conditions optimization:

    • Test multiple IPTG concentrations (0.01-1 mM)

    • Vary induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Adjust induction duration (3h, 6h, overnight)

    • Try different media formulations (LB, TB, 2YT)

  • Solubility enhancement:

    • Include solubilizing fusion partners (MBP, SUMO, TrxA)

    • Add membrane protein-specific chaperones (GroEL/ES, DnaK)

    • Test specialized E. coli strains (C41/C43, designed for membrane proteins)

  • Protein toxicity mitigation:

    • Use tightly regulated promoters to prevent leaky expression

    • Employ host strains containing additional tRNA genes for rare codons

    • Consider cell-free expression systems for toxic proteins

  • Purification optimization:

    • Test different detergents for solubilization (DDM, LDAO, Triton X-100)

    • Optimize imidazole concentrations in wash and elution buffers

    • Add stabilizing agents during purification (glycerol, trehalose)

Documentation of optimization trials in a structured format will help identify patterns affecting expression success.

What experimental controls are essential when evaluating the functional impact of MT-ND3 variants in complex I activity assays?

When evaluating the functional impact of MT-ND3 variants, the following essential controls should be included:

  • Positive controls:

    • Wild-type MT-ND3 construct expressed under identical conditions

    • Known functional mitochondrial complex I (commercial or well-characterized)

    • Positive control inhibitor (rotenone at 2-5 μM) to confirm assay specificity

  • Negative controls:

    • Empty vector transfection/transduction

    • Known pathogenic MT-ND3 variants (e.g., m.10191T>C, m.10197G>C)

    • Complex I-deficient cell line or isolated mitochondria

  • Technical controls:

    • Verification of equal protein loading across samples

    • Measurement of other respiratory chain complexes (II-V) to ensure specificity

    • Assessment of mitochondrial content (citrate synthase activity)

    • Monitoring of MT-ND3 expression levels by western blot

  • Experimental validation:

    • Dose-response relationships with substrates and inhibitors

    • Time-course measurements to capture kinetic differences

    • Replication across multiple independent experiments

    • Testing under different physiological stress conditions (e.g., hypoxia)

These controls enable accurate interpretation of variant effects by establishing baseline activity levels, confirming assay specificity, and distinguishing variant-specific effects from experimental artifacts.

What analytical techniques can be used to assess the quality and structural integrity of purified recombinant MT-ND3 protein?

A comprehensive quality assessment of purified recombinant MT-ND3 should employ these analytical techniques:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>90% purity benchmark)

    • Western blot with anti-His and anti-MT-ND3 antibodies

    • Capillary electrophoresis for high-resolution purity analysis

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Intrinsic tryptophan fluorescence to monitor tertiary structure

    • Differential scanning fluorimetry (DSF) to determine thermal stability

    • Size exclusion chromatography to evaluate aggregation state

  • Mass analysis:

    • MALDI-TOF or ESI-MS to confirm molecular weight

    • LC-MS/MS peptide mapping for sequence verification and post-translational modification identification

  • Functional characterization:

    • NADH oxidation activity assays

    • Binding studies with complex I partners using microscale thermophoresis

    • Reconstitution into liposomes to assess membrane integration

  • Storage stability monitoring:

    • Time-course activity measurements under various storage conditions

    • Freeze-thaw stability testing with activity retention quantification

The combined data from these techniques provides a comprehensive profile of protein quality and helps predict functionality in downstream applications.

How can researchers interpret differences in kinetic parameters of wild-type versus variant MT-ND3 in complex I activity assays?

Interpreting kinetic parameters of wild-type versus variant MT-ND3 requires systematic analysis:

  • Key parameters to measure and compare:

ParameterSignificanceTypical Wild-Type ValuesVariant Effect Interpretation
VmaxMaximum reaction velocity100-200 nmol/min/mg proteinReduction suggests catalytic defect
Km for NADHSubstrate affinity10-30 μMIncrease suggests binding defect
Km for ubiquinoneSubstrate affinity40-80 μMIncrease suggests ubiquinone interaction issue
IC50 for rotenoneInhibitor sensitivity5-20 nMAltered value suggests structural changes
Activation energyReaction energy barrier30-50 kJ/molIncrease suggests less efficient catalysis
pH optimumProton sensitivitypH 7.5-8.0Shift suggests altered protonation sites
  • Interpretation framework:

    • Statistically significant changes (p<0.05) in multiple parameters suggest functional impact

    • Correlate kinetic changes with structural location of variant

    • Compare with known pathogenic variants as benchmarks

    • Assess temperature dependence to detect stability versus catalytic effects

  • Mechanistic classification:

    • Assembly defects: Reduced Vmax with unchanged Km values

    • Catalytic defects: Reduced Vmax with altered Km values

    • Regulatory defects: Altered response to pH, ions, or membrane potential

    • Stability defects: Time-dependent activity loss and temperature sensitivity

  • Physiological relevance assessment:

    • Compare in vitro activity changes to cellular ATP production

    • Correlate with ROS production and mitochondrial membrane potential

This systematic approach allows researchers to distinguish between primary catalytic defects and secondary consequences, providing insight into the molecular mechanisms underlying MT-ND3 variant effects.

What computational approaches can predict the functional impact of newly identified MT-ND3 variants in Halichoerus grypus?

Computational prediction of MT-ND3 variant effects should utilize a multi-tiered approach:

  • Sequence-based analysis:

    • Conservation scoring (ConSurf, PhyloP) to identify evolutionarily constrained residues

    • Variant effect predictors (PolyPhen-2, SIFT, MutationTaster) adapted for mitochondrial proteins

    • Mitochondrial-specific tools (MitoTIP, MitImpact) that account for mitochondrial genetic code

  • Structural impact prediction:

    • Homology modeling based on mammalian complex I structures

    • Energy minimization and molecular dynamics simulations to assess structural stability

    • ΔΔG calculations to quantify folding energy changes (FoldX, I-Mutant)

    • Protein-protein interaction interface analysis (PISA, Interactome3D)

  • Systems biology approaches:

    • Metabolic control analysis to predict flux effects through OXPHOS

    • Machine learning models trained on known MT-ND3 variants and their phenotypes

    • Network analysis incorporating complex I assembly pathways

  • Comparative genomics:

    • Analysis of natural variation across marine mammals to identify adaptive versus deleterious variants

    • Assessment of coevolution patterns with interacting subunits

  • Validation metrics:

    • Concordance between multiple prediction methods

    • Calibration against known pathogenic and benign variants in MT-ND3

    • Performance evaluation using cross-validation

Researchers should employ these complementary approaches to build confidence in predictions, particularly for novel variants in less-studied species like Halichoerus grypus.

How do post-translational modifications affect MT-ND3 function, and what techniques can identify these modifications in recombinant versus native protein?

Post-translational modifications (PTMs) on MT-ND3 play crucial roles in regulating complex I function, particularly under changing metabolic and stress conditions:

  • Known and predicted PTMs on MT-ND3:

    • Phosphorylation of serine/threonine residues affecting complex I activity

    • Acetylation potentially regulating protein-protein interactions

    • S-nitrosylation of cysteine residues during ischemia/reperfusion

    • Oxidative modifications as markers of oxidative stress

    • Ubiquitination potentially targeting damaged protein for degradation

  • PTM detection techniques:

    • Mass spectrometry-based methods:

      • Enrichment strategies (IMAC for phosphopeptides, antibody-based enrichment)

      • High-resolution LC-MS/MS with HCD and ETD fragmentation

      • Parallel reaction monitoring for targeted PTM quantification

    • Gel-based approaches:

      • Phospho-specific staining (Pro-Q Diamond)

      • Western blotting with PTM-specific antibodies

      • 2D gel electrophoresis for charge-based separation of modified forms

  • Comparing recombinant versus native MT-ND3:

    • Recombinant systems typically lack mammalian PTM machinery

    • Co-expression with relevant kinases/acetyltransferases may partially recapitulate PTMs

    • Cross-species comparison of PTM patterns may reveal conserved regulatory mechanisms

    • In vitro enzymatic modification to introduce specific PTMs

  • Functional validation of PTMs:

    • Site-directed mutagenesis of modified residues (phosphomimetic mutations)

    • Activity assays under conditions promoting/inhibiting specific modifications

    • Time-course studies following induced stress or metabolic changes

Understanding the PTM landscape provides insights into regulatory mechanisms that may be particularly important in marine mammals adapted to diving physiology and hypoxic conditions.

How can recombinant MT-ND3 be utilized in developing therapies for mitochondrial diseases associated with MT-ND3 mutations?

Recombinant MT-ND3 offers several therapeutic development pathways for mitochondrial diseases:

  • Allotopic expression strategies:

    • Codon-optimized MT-ND3 gene therapy has shown promise in rescuing MT-ND3 variant phenotypes

    • Delivery vehicles include AAV and lentiviral vectors with tissue-specific promoters

    • Mitochondrial targeting sequences optimization for efficient import

    • Quantifiable improvements in ATP production demonstrate functional rescue potential

  • Drug screening platforms:

    • Recombinant MT-ND3 in biochemical assays to screen compound libraries

    • Cell-based models expressing variant MT-ND3 for phenotypic screening

    • Structure-based drug design targeting MT-ND3 interaction sites

    • Repurposing approved drugs that modulate complex I activity

  • Protein replacement approaches:

    • Peptide-based delivery systems to introduce functional MT-ND3 protein

    • Nanoparticle formulations for targeted mitochondrial delivery

    • Cell-penetrating peptide fusions for enhanced cellular uptake

  • Personalized medicine applications:

    • Patient-specific variants can be recreated in cell models

    • Functional testing of potential therapies on patient-derived cells

    • Biomarker development for treatment monitoring

  • Combination therapy development:

    • Antioxidants targeting downstream effects of complex I dysfunction

    • Metabolic modulators to bypass complex I (e.g., succinate-based approaches)

    • CRISPR/Cas9-based heteroplasmy shifting for mtDNA mutations

Recent advances have demonstrated that nuclear expression of codon-optimized MT-ND3 can partially restore protein levels, complex I activity, and ATP production in cells with MT-ND3 variants, indicating promising therapeutic potential .

What comparative insights can be gained from studying MT-ND3 across marine mammal species with different diving capabilities?

Comparative analysis of MT-ND3 across marine mammals offers unique insights into evolutionary adaptations:

  • Diving physiology correlations:

    • Species with deeper diving capabilities (e.g., elephant seals, sperm whales) may show distinctive MT-ND3 sequence adaptations compared to shallow divers

    • Amino acid substitutions in MT-ND3 may correlate with maximum dive duration and depth

    • Positive selection analysis can identify residues under selection pressure in lineages with enhanced diving capabilities

  • Hypoxia adaptation mechanisms:

    • MT-ND3 modifications may contribute to more efficient electron transport under low oxygen

    • Comparative oxygen affinity studies of complex I across species

    • Analysis of ROS production during simulated dive cycles in different species

  • Methodological approaches:

    • Heterologous expression of MT-ND3 from different marine mammals

    • Chimeric constructs to identify functional domains responsible for species-specific properties

    • Biophysical characterization under varying oxygen tensions and pressures

    • Respirometry comparing mitochondrial function across species

  • Conservation implications:

    • Understanding critical residues helps predict climate change vulnerability

    • Identification of variants that might compromise adaptive capacity

    • Development of molecular markers for population health monitoring

  • Translational potential:

    • Marine mammal adaptations may inspire therapeutic strategies for human ischemia-reperfusion injuries

    • Biomedical applications for conditions involving hypoxic stress

    • Biomimetic approaches to improve mitochondrial function during oxygen limitation

This comparative approach provides evolutionary context to functional adaptations and may reveal convergent or divergent solutions to the challenges of diving physiology across marine mammal lineages.

What are the current technological limitations in studying MT-ND3 function, and what emerging technologies might overcome these challenges?

Current technological limitations and emerging solutions in MT-ND3 research include:

  • Current limitations:

    • Hydrophobicity challenges in expression and purification

    • Limited structural information at atomic resolution

    • Difficulty studying the protein in isolation due to complex I interdependence

    • Challenges in real-time monitoring of function and dynamics

    • Limited tools for studying tissue-specific effects in vivo

  • Emerging technologies and solutions:

TechnologyApplication to MT-ND3 ResearchPotential Advantage
Cryo-EMHigh-resolution structural analysisVisualization of MT-ND3 in native complex I environment
Organoid modelsSpecies-specific mitochondrial functionMore physiologically relevant than cell lines
CRISPR/Cas9 mtDNA editingDirect modification of mtDNA MT-ND3Study mutations in endogenous context
NanobodiesSpecific targeting of MT-ND3 conformationsProbe function without interfering with activity
Single-molecule techniquesReal-time functional dynamicsCapture transient states during catalysis
In situ cryo-electron tomographyVisualization in cellular contextUnderstand native organization and interactions
Advanced computational methodsMolecular dynamics simulationsModel conformational changes during catalysis
Microfluidic respirometryHigh-throughput functional analysisScreen conditions and compounds efficiently
Mitochondria-targeted biosensorsReal-time activity monitoringCorrelate complex I function with cellular physiology
  • Integration of technologies:

    • Multi-scale approaches combining structural, functional, and computational methods

    • Systems biology frameworks integrating -omics data with functional studies

    • Interdisciplinary collaborations between molecular biologists, structural biologists, and biophysicists

These technological advances promise to overcome current limitations, providing deeper insights into MT-ND3 function in health and disease, as well as its evolutionary adaptations in marine mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.