Recombinant Halichoerus grypus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Biochemical Definition and Functional Role

MT-ND4L is a mitochondrial gene-encoded subunit of Complex I, responsible for transferring electrons from NADH to ubiquinone during oxidative phosphorylation . In Halichoerus grypus (gray seal), the recombinant protein retains its core structural and functional properties:

  • Primary Function: Facilitates electron transfer in the mitochondrial inner membrane, contributing to ATP synthesis .

  • Protein Characteristics:

    • Molecular Weight: ~10.7 kDa .

    • Amino Acid Length: 98 residues .

    • EC Number: 1.6.5.3 .

Production Parameters

Recombinant MT-ND4L from H. grypus is synthesized using diverse expression systems, with standardized quality controls:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells .
Purity≥85% (SDS-PAGE validated) .
TaggingTag type determined during manufacturing (e.g., His-tag, GST) .
Storage Conditions- Liquid: 6 months at -20°C/-80°C .
- Lyophilized: 12 months at -20°C/-80°C .
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Key Product Variants

Product CodeSourceProtein LengthUniprot ID
CSB-EP015080HAU1-BE. coliPartialP68309
CSB-BP015080HAU1BaculovirusPartialP68309

Sources: Cusabio product specifications .

Gene and Protein Architecture

  • Gene Overlap: The MT-ND4L gene overlaps with MT-ND4 (3-nucleotide overlap), enabling compact mitochondrial genome organization .

  • Protein Topology: A multi-pass transmembrane protein with hydrophobic domains, forming the core of Complex I’s membrane arm .

  • Electron Transfer Pathway:

    1. NADH Binding: Electrons from NADH reduce FMN to FMNH₂.

    2. Iron-Sulfur Clusters: Transfer electrons to ubiquinone via Fe-S centers .

    3. Proton Pumping: Conformational changes drive H⁺ extrusion, generating a proton gradient .

Disease Associations

MT-ND4L mutations are implicated in mitochondrial disorders:

DiseaseMutationFunctional Impact
Leber’s Hereditary Optic Neuropathy (LHON)T>C at position 10,663 (V65A)Disrupts Complex I proton pumping, reducing ATP synthesis .
Metabolic DisordersVariants linked to BMI, obesity, diabetesImpaired oxidative phosphorylation in adipose tissue .

Research Applications

  • Complex I Assembly Studies: Recombinant MT-ND4L aids in mapping subunit interactions and electron transfer mechanisms .

  • Protein Expression Optimization: Host-dependent yields and solubility are critical for structural studies (e.g., crystallography) .

Comparative Analysis of Host Systems

HostAdvantagesLimitations
E. coliHigh yield, cost-effectiveLimited post-translational modifications
BaculovirusProper folding for membrane proteinsLower throughput, specialized facilities required

Data derived from production protocols in sources .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Halichoerus grypus (Gray seal)
Target Names
Target Protein Sequence
MSMVYANIFLAFIMSLMGLLMYRSHLMSSLLCLEGMMLSLFVMMTVTILNNHFTLASMAP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein subunit of the mitochondrial respiratory complex I. This protein plays a critical role in the first step of the electron transport process during oxidative phosphorylation, transferring electrons from NADH to ubiquinone. MT-ND4L is specifically associated with the proton translocation pathway within complex I .

In gray seals (Halichoerus grypus), as in other mammals, MT-ND4L is encoded by the mitochondrial genome and contributes to energy production through ATP synthesis. The protein functions within the inner mitochondrial membrane, where the electron transport chain creates an electrical charge difference that drives ATP production .

Why is gray seal (Halichoerus grypus) MT-ND4L of interest to researchers?

Gray seal MT-ND4L is of particular interest for comparative mitochondrial studies due to the species' adaptation to marine environments. Halichoerus grypus belongs to the family Phocidae (true seals or earless seals) and is distributed across the North Atlantic Ocean .

Studying the mitochondrial proteins of marine mammals like gray seals provides insights into evolutionary adaptations for deep diving, cold temperature tolerance, and hypoxic conditions. The genetic distinction between eastern and western Atlantic populations, which have been genetically distinct for at least one million years , makes this species valuable for studying mitochondrial evolution and functional adaptations in different environmental contexts.

How does recombinant MT-ND4L compare structurally to native protein?

Recombinant MT-ND4L typically includes additional elements not found in the native protein, such as affinity tags (commonly His-tags) that facilitate purification. While the amino acid sequence of the core protein should match the native sequence, the addition of these tags and potential differences in post-translational modifications may affect protein folding and function.

What expression systems are most effective for producing functional recombinant H. grypus MT-ND4L?

Based on protocols for similar mitochondrial membrane proteins, E. coli remains the most common expression system for recombinant MT-ND4L production . For optimal expression of functional gray seal MT-ND4L, researchers should consider the following approaches:

Expression System Comparison:

Expression SystemAdvantagesLimitationsBest For
E. coli (BL21)High yield, cost-effective, rapid growthMay form inclusion bodies, limited post-translational modificationsInitial structural studies, antibody production
E. coli C41/C43Improved membrane protein expressionStill lacks eukaryotic modificationsFunctional studies requiring proper folding
Insect cellsBetter for complex eukaryotic proteinsMore expensive, slowerStudies requiring authentic folding
Mammalian cellsMost authentic post-translational modificationsHighest cost, lowest yieldCritical functional studies

When using E. coli as the expression system, incorporating a fusion partner such as MBP (maltose-binding protein) or SUMO can improve solubility. For functional studies, expression at lower temperatures (16-20°C) often improves proper folding of membrane proteins .

What purification strategy yields the highest purity and activity for recombinant MT-ND4L?

Purification of recombinant MT-ND4L requires specialized approaches due to its hydrophobic nature as a membrane protein. An effective purification strategy includes:

  • Solubilization: Use of mild detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin to extract the protein from membranes while maintaining native folding.

  • Affinity Chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) with Ni-NTA resin in the presence of detergent .

  • Size Exclusion Chromatography: Further purification based on molecular size to remove aggregates and contaminants.

Recommended Buffer Conditions:

  • Extraction buffer: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 1% DDM, protease inhibitors

  • Wash buffer: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.1% DDM, 20 mM imidazole

  • Elution buffer: 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 0.1% DDM, 250 mM imidazole

For long-term storage, addition of 6% trehalose as a stabilizing agent is recommended , with aliquoting and storage at -80°C to prevent repeated freeze-thaw cycles.

How can the proton translocation activity of recombinant MT-ND4L be measured in vitro?

Measuring proton translocation activity of recombinant MT-ND4L requires specialized techniques that reconstitute the protein in an environment mimicking the mitochondrial membrane. The following methodologies are recommended:

  • Liposome Reconstitution Assay: Incorporate purified MT-ND4L into liposomes with appropriate lipid composition (particularly POPC, which comprises ~40% of the inner mitochondrial membrane) .

  • pH-Sensitive Fluorescent Probes: Use probes such as ACMA (9-amino-6-chloro-2-methoxyacridine) or pyranine to monitor pH changes inside liposomes upon addition of electron donors.

  • Patch-Clamp Electrophysiology: For direct measurement of proton currents through the reconstituted protein.

Protocol Overview for Liposome-Based Assay:

  • Reconstitute purified MT-ND4L in POPC liposomes (protein:lipid ratio of 1:100)

  • Load liposomes with pH-sensitive fluorescent probe

  • Establish proton gradient by addition of electron donors (NADH)

  • Monitor fluorescence changes as indicator of proton translocation

The functional analysis should include appropriate controls such as liposomes without protein and liposomes with known proton channel proteins.

What structural analysis methods best capture the conformational dynamics of MT-ND4L during proton translocation?

Understanding the conformational dynamics of MT-ND4L during proton translocation requires combining several structural analysis techniques:

  • Molecular Dynamics (MD) Simulations: This computational approach can model the movements of the protein within a lipid bilayer over time. MD simulations have successfully revealed conformational changes in ND4L that affect proton translocation pathways .

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of the protein with different solvent accessibility during functional states.

  • Cryo-Electron Microscopy (Cryo-EM): For capturing different conformational states of the protein in near-native environments.

MD simulations have revealed that specific residues, particularly charged amino acids like Glu34, play critical roles in recruiting water molecules for proton translocation across the membrane . The simulation can be performed using software packages like Amber18 with the protein embedded in a POPC lipid bilayer, followed by analysis using visualization programs like VMD.

How do mutations in MT-ND4L affect proton channel formation and respiratory complex I function?

  • Altered Hydrogen Bonding Networks: Mutations can disrupt critical hydrogen bonds that maintain the architecture of the proton translocation pathway. For example, the M47T mutation creates new hydrogen bonds that alter loop conformation in the protein .

  • Changed Hydrophobic Interactions: Mutations like C69W introduce bulkier amino acids that affect the hydrophobic interactions within the protein, potentially changing helix organization and stability .

  • Water Molecule Recruitment Disruption: Some mutations alter the conformation of key residues like Glu34 that normally recruit water molecules to facilitate proton movement across the membrane. When these residues form new hydrogen bonds (e.g., between Glu34 and Tyr157), they limit water passage and disrupt proton translocation .

What evolutionary differences exist between MT-ND4L in Halichoerus grypus and other mammals?

Evolutionary analysis of MT-ND4L across mammalian species reveals adaptations potentially related to metabolic requirements in different environments. For gray seals (Halichoerus grypus), several noteworthy differences exist:

  • Subspecies Variation: The genetic distinction between eastern and western Atlantic gray seal populations suggests possible functional adaptations in mitochondrial genes like MT-ND4L . These differences may reflect adaptations to different environmental conditions across the North Atlantic.

  • Marine Mammal Adaptations: Comparative analysis between terrestrial mammals and marine mammals like gray seals typically reveals amino acid substitutions in MT-ND4L that may contribute to:

    • Enhanced oxidative phosphorylation efficiency during diving

    • Improved reactive oxygen species (ROS) management

    • Adaptation to temperature variations in marine environments

  • Conservation Patterns: Certain amino acid residues involved in proton translocation are highly conserved across species, while regions not directly involved in channel formation show greater variability.

A comprehensive phylogenetic analysis would require comparing the MT-ND4L sequences across multiple species with consideration for their ecological niches and metabolic demands.

What controls are essential when conducting functional studies with recombinant H. grypus MT-ND4L?

Robust experimental design for functional studies with recombinant Halichoerus grypus MT-ND4L requires several essential controls:

  • Negative Controls:

    • Empty vector expressions processed identically to MT-ND4L-containing constructs

    • Liposomes without incorporated protein

    • Heat-denatured MT-ND4L protein

    • Known inactive mutants of MT-ND4L

  • Positive Controls:

    • Reconstituted native mitochondrial complex I (when available)

    • Well-characterized proton translocating proteins

    • Recombinant human MT-ND4L as a comparative standard

  • Validation Controls:

    • Parallel experiments with multiple batches of purified protein

    • Concentration gradients to establish dose-dependent effects

    • Multiple methodologies to confirm observed effects

  • Environmental Controls:

    • Temperature range testing (10-37°C) to mimic physiological conditions

    • pH variation experiments (pH 6.5-8.0)

    • Lipid composition variations to determine membrane effects

These controls help distinguish true biological activities from artifacts related to the recombinant protein production, purification process, or experimental system.

How can researchers incorporate recombinant MT-ND4L into functional respiratory chain complexes?

Successfully incorporating recombinant MT-ND4L into functional respiratory chain complexes requires a stepwise approach:

  • Co-expression Strategies: Express MT-ND4L along with adjacent subunits (particularly ND6) to facilitate proper assembly, as these proteins form a functional module within complex I .

  • Reconstitution Approaches:

    • Partial Complex Assembly: Combine purified recombinant MT-ND4L with other purified subunits under controlled conditions

    • Incorporation into Depleted Mitochondrial Preparations: Add recombinant protein to mitochondrial preparations specifically depleted of endogenous MT-ND4L

    • Nanodiscs Technology: Use nanodiscs to create stable membrane environments for complex assembly

  • Functional Validation Methods:

    • NADH:ubiquinone oxidoreductase activity assays

    • Oxygen consumption measurements

    • Membrane potential monitoring with fluorescent dyes

    • Electron paramagnetic resonance (EPR) spectroscopy to assess iron-sulfur cluster incorporation

Assembly Efficiency Table:

Reconstitution MethodSuccess RateFunctional ActivityTechnical ComplexityBest Application
Direct incorporation into liposomesHighLow to moderateLowBasic proton translocation studies
Co-expression with partner subunitsModerateModerate to highModerateSubcomplex functional studies
Incorporation into nanodiscsModerateModerate to highHighDetailed structural studies
Addition to depleted mitochondrial fractionsLowHigh (when successful)Very highComplete complex I studies

How can contradictory results in MT-ND4L functional studies be reconciled?

Researchers frequently encounter contradictory results when studying complex membrane proteins like MT-ND4L. These discrepancies can be systematically addressed through:

  • Methodological Standardization:

    • Compare protein preparation protocols, particularly detergent types and concentrations

    • Standardize lipid compositions for reconstitution experiments

    • Ensure consistent buffer conditions, particularly pH and salt concentrations

  • Statistical Approaches:

    • Implement Bayesian analysis to integrate conflicting datasets

    • Use meta-analysis techniques when multiple studies are available

    • Develop statistical models that account for experimental variability

  • Molecular Explanations:

    • Consider conformational heterogeneity of the protein

    • Evaluate the impact of recombinant tags on protein function

    • Assess the formation of different subcomplexes within preparations

  • Collaborative Cross-Validation:

    • Organize ring trials where multiple laboratories test identical samples

    • Share raw data and detailed protocols through repositories

    • Implement orthogonal techniques to validate controversial findings

When analyzing conflicting results, researchers should systematically document all experimental variables including protein source, purification method, experimental conditions, and detection techniques to identify potential sources of discrepancy.

What bioinformatic approaches best predict the impact of mutations in H. grypus MT-ND4L?

Predicting the functional impact of mutations in Halichoerus grypus MT-ND4L requires specialized bioinformatic approaches tailored to mitochondrial membrane proteins:

  • Sequence-Based Methods:

    • Conservation analysis across species (ConSurf, Evolutionary Trace)

    • Machine learning predictors trained on mitochondrial datasets

    • Coevolution analysis to identify functionally coupled residues

  • Structure-Based Approaches:

    • Homology modeling using established structures (e.g., PDB ID: 5XTC)

    • Energy calculation of native versus mutant structures

    • Molecular dynamics simulations to assess dynamic effects of mutations

  • Integrated Functional Prediction:

    • Proton channel pathway mapping and disruption analysis

    • Protein-protein interaction interface prediction

    • Electrostatic potential surface calculation

The molecular dynamics simulation approach has proven particularly valuable for mutations in MT-ND4L. This method involves building a transmembrane system with the protein embedded in a POPC lipid bilayer, followed by simulation using software like Amber18 . Analysis of water molecule movement through the protein provides insights into how mutations affect proton translocation capability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.