Recombinant Haloarcula argentinos Cruxrhodopsin-1 (cop1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cop1; Cruxrhodopsin-1; COP-1; CR-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Haloarcula argentinensis
Target Names
cop1
Target Protein Sequence
MPEPGSEAIWLWLGTAGMFLGMLYFIARGWGETDSRRQKFYIATILITAIAFVNYLAMAL GFGLTIVEFAGEEHPIYWARYSDWLFTTPLLLYDLGLLAGADRNTITSLVSLDVLMIGTG LVATLSPGSGVLSAGAERLVWWGISTAFLLVLLYFLFSSLSGRVADLPSDTRSTFKTLRN LVTVVWLVYPVWWLIGTEGIGLVGIGIETAGFMVIDLTAKVGFGIILLRSHGVLDGAAET TGTGATPADD
Uniprot No.

Target Background

Function
Light-driven proton pump.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haloarcula argentinos Cruxrhodopsin-1 (cop1) and what is its taxonomic classification?

Cruxrhodopsin-1 (cop1), also known as COP-1 or CR-1, is a microbial rhodopsin from the archaeal species Haloarcula argentinos (strain arg-1) . It belongs to the broader family of microbial rhodopsins, which are seven-transmembrane proteins that utilize retinal as a chromophore. Taxonomically, it comes from extremophilic archaea that thrive in high-salt environments. The cruxrhodopsin family forms a distinct phylogenetic group that is separate from both bacteriorhodopsin and archaerhodopsin families, despite sharing similar functions .

How does Cruxrhodopsin-1 differ from Cruxrhodopsin-2 and other related proteins?

Cruxrhodopsin-1 shares significant sequence homology with other microbial rhodopsins but maintains distinct characteristics:

ProteinSequence Identity with Cruxrhodopsin-1Key Differences
Cruxrhodopsin-277%Found in Haloarcula sp. arg-2; 255 amino acids; molecular mass of 27,544 Da
Bacteriorhodopsin50%The prototypical light-driven proton pump from Halobacterium salinarium
Archaerhodopsin-148%Different photocycle kinetics and pH dependence
Archaerhodopsin-248%Structural variations in the proton release pathway
Cruxhalorhodopsin-1 (choP1)Low similarityDifferent function; amino acid sequence PMILLALGLLADTDIASLFTAITMDIGMCVTGLAAALITSS...

Despite these differences, the charged amino acids critical for proton pumping function are conserved across these proteins, indicating functional similarity in their core mechanism .

What are the optimal storage conditions for recombinant Cruxrhodopsin-1?

For optimal preservation of recombinant Cruxrhodopsin-1 activity and structure:

  • Store at -20°C for regular use, or at -80°C for extended storage periods

  • The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized for stability

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • Working aliquots may be stored at 4°C for up to one week

  • For experimental reproducibility, it is recommended to prepare small aliquots during initial receipt to minimize freeze-thaw cycles

Proper storage is critical as membrane proteins like rhodopsins are particularly sensitive to denaturation and loss of tertiary structure, which directly impacts their functionality in experimental settings.

What reconstitution methods are recommended for functional studies of Cruxrhodopsin-1?

When preparing Cruxrhodopsin-1 for functional studies:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50%

  • For membrane incorporation studies, the protein can be reconstituted into liposomes using methods similar to those established for bacteriorhodopsin:

    • Detergent solubilization followed by dialysis

    • Direct incorporation into preformed liposomes

    • Bio-bead mediated detergent removal

The choice of lipids for reconstitution should consider the halophilic origin of the protein, with archaeal lipids or lipids with branched chains potentially providing better functional reconstitution than standard phospholipids.

What is the functional role of Cruxrhodopsin-1 and how does it compare to other rhodopsins?

Cruxrhodopsin-1 functions as a light-driven proton pump, similar to bacteriorhodopsin . Upon absorption of light, it undergoes a photocycle that results in the translocation of protons across the membrane from the cytoplasmic to the extracellular side. This creates a proton gradient that can be utilized by the cell for ATP synthesis via ATP synthase.

Comparative analysis reveals:

  • Cruxrhodopsin-1 belongs to a distinct family of ion pump rhodopsins, separate from both bacteriorhodopsin and archaerhodopsin families

  • The related Cruxrhodopsin-2 accounts for only 0.05 nmol/mg protein in its native host, which is 20-30 fold less abundant than bacteriorhodopsin in Halobacterium salinarium R1M1

  • Unlike some halobacterial systems, Haloarcula sp. arg-2 (with Cruxrhodopsin-2) shows light-induced proton extrusion concurrent with ATP level increase without transient proton uptake under anaerobic conditions

  • The apparent stoichiometry of H+/ATP is estimated to be more than three in the natural bR+hR- strain

These functional characteristics suggest specialized adaptations that may be relevant to the specific environmental conditions of Haloarcula species.

What spectroscopic methods are most effective for characterizing the photocycle of Cruxrhodopsin-1?

To effectively characterize the photocycle of Cruxrhodopsin-1, researchers should consider:

  • Time-resolved absorption spectroscopy:

    • Enables tracking of the formation and decay of photointermediates

    • Typical time scales range from femtoseconds to seconds to capture the complete photocycle

  • FTIR (Fourier Transform Infrared) spectroscopy:

    • Provides information about protein structural changes during the photocycle

    • Particularly useful for monitoring protonation/deprotonation events

  • Resonance Raman spectroscopy:

    • Allows detailed characterization of the retinal chromophore configuration

    • Helps identify specific bonds and structural changes during photoactivation

  • pH-sensitive dye-based assays:

    • For monitoring proton pumping activity in reconstituted systems

    • Provides functional correlation with spectroscopic data

When designing these experiments, it's important to consider that different intermediates may have overlapping spectra, requiring careful deconvolution techniques for accurate analysis.

What are effective experimental designs for measuring the proton pumping activity of Cruxrhodopsin-1?

To measure proton pumping activity of reconstituted Cruxrhodopsin-1, consider these methodological approaches:

  • pH electrode measurements:

    • Direct monitoring of pH changes in the external medium upon illumination

    • Requires proper buffering to detect small pH changes

    • Light-induced pH changes should be calibrated against known amounts of H+

  • Fluorescent pH indicators:

    • Higher sensitivity than electrode-based methods

    • Can be used for both bulk measurements and single-vesicle studies

    • Examples include pyranine (internal vesicle pH) and HPTS (external pH)

  • Proton gradient formation in proteoliposomes:

    • Measurement of ΔpH using membrane-permeable weak acids/bases

    • Quantification of ion gradients across the membrane

  • Patch-clamp electrophysiology:

    • Direct measurement of photocurrents in cells expressing Cruxrhodopsin-1

    • Allows precise control of membrane potential and ion conditions

MethodAdvantagesLimitationsKey Controls
pH electrodeSimple setup, direct measurementLower sensitivity, slow responseDark controls, ionophore calibration
Fluorescent indicatorsHigh sensitivity, spatial resolutionPotential interference with proteinIndicator calibration curves
ProteoliposomesControlled environmentComplex preparationProtein-free liposomes
Patch-clampSingle-molecule resolutionTechnical complexityCells without rhodopsin

For all methods, include appropriate controls such as dark conditions, protonophore addition (e.g., CCCP), and comparison with well-characterized rhodopsins like bacteriorhodopsin .

How can researchers distinguish between properly folded and misfolded recombinant Cruxrhodopsin-1?

Assessing the folding quality of recombinant Cruxrhodopsin-1 is critical for experimental reliability. Several complementary approaches can be employed:

  • Absorbance spectroscopy:

    • Properly folded rhodopsin with bound retinal shows characteristic absorption maximum around 550-570 nm

    • Ratio of protein absorption (280 nm) to chromophore absorption provides purity assessment

    • Misfolded protein typically shows aggregation and scattering

  • Circular dichroism (CD) spectroscopy:

    • Secondary structure evaluation (alpha-helical content should be high)

    • Thermal stability assessment through temperature scans

  • Size-exclusion chromatography:

    • Monitors aggregation state and oligomerization

    • Properly folded protein should elute as a monodisperse peak

  • SDS-PAGE analysis:

    • Properly folded membrane proteins often show gel shifting when samples are not heat-denatured

    • Heat modifiability is a hallmark of correctly folded alpha-helical membrane proteins

  • Functional assays:

    • Light-induced proton pumping activity correlates with proper folding

    • Photobleaching rates can indicate native-like retinal environment

Establishing a correlation between structural characteristics and functional activity provides the most reliable assessment of protein quality.

How can Cruxrhodopsin-1 be utilized in optogenetic applications?

Cruxrhodopsin-1 has potential applications in optogenetics based on its proton-pumping capabilities:

  • Neural silencing tools:

    • Hyperpolarization of neurons through proton extrusion

    • Advantages over archaerhodopsin-based tools may include different spectral properties and kinetics

    • Could complement existing inhibitory opsins for multicolor optogenetics

  • Design considerations for optogenetic applications:

    • Codon optimization for expression in mammalian cells

    • Addition of trafficking sequences for efficient membrane localization

    • Fusion with fluorescent proteins for expression verification

    • Potential mutations to alter spectral properties or kinetics

  • Comparative advantages:

    • The distinct spectral and kinetic properties of Cruxrhodopsin-1 could provide alternative optogenetic tools

    • Natural evolution in extreme environments may confer enhanced stability

    • The relatedness to both bacteriorhodopsin and archaerhodopsin (48-50% identity) suggests intermediate properties that could be advantageous

For successful application, membrane trafficking and expression efficiency in mammalian cells would need to be optimized through protein engineering approaches.

What are recommended approaches for studying the interaction between Cruxrhodopsin-1 and lipids?

The lipid environment significantly impacts rhodopsin function and stability. Recommended approaches include:

  • Lipid composition screening:

    • Systematic testing of different lipid compositions for optimal protein function

    • Native-like archaeal lipids versus conventional phospholipids

    • Effect of lipid headgroups, acyl chain length, and saturation

  • Biophysical techniques for lipid-protein interactions:

    • Fluorescence anisotropy to measure membrane fluidity effects

    • Electron paramagnetic resonance (EPR) with spin-labeled lipids

    • Deuterium NMR to analyze lipid acyl chain ordering near the protein

  • Functional correlation studies:

    • Measurement of proton pumping rates in different lipid environments

    • Thermal stability assessment in various lipid compositions

    • Photocycle kinetics as a function of membrane composition

  • Molecular dynamics simulations:

    • In silico analysis of protein-lipid interactions

    • Identification of potential lipid binding sites

    • Prediction of how lipid environment affects protein dynamics

When designing these experiments, it's important to consider the halophilic origin of Haloarcula argentinos, which suggests adaptation to unique membrane environments with high negative surface charge and specific lipid compositions.

What are common challenges in expressing recombinant Cruxrhodopsin-1 and how can they be addressed?

Expression of functional Cruxrhodopsin-1 presents several challenges:

  • Membrane protein expression issues:

    • Low expression levels due to toxicity or improper folding

    • Inclusion body formation

    • Solution: Test different expression systems (E. coli, yeast, insect cells); optimize induction conditions (temperature, inducer concentration, time)

  • Retinal incorporation:

    • Insufficient retinal incorporation leads to non-functional protein

    • Solution: Supplement expression media with all-trans retinal; optimize retinal:protein ratio

  • Protein solubilization:

    • Inefficient extraction from membranes

    • Solution: Screen detergents (DDM, OG, LDAO) for optimal solubilization; consider native archaeal lipid extracts

  • Halophilic protein challenges:

    • Potential requirement for high salt concentration for stability

    • Solution: Maintain high salt conditions during purification; consider stabilizing mutations

  • Purification difficulties:

    • Co-purification of contaminating proteins

    • Solution: Utilize affinity tags (His-tag is commonly used ); implement additional purification steps (ion exchange, size exclusion)

A systematic approach to optimization, potentially guided by successful protocols for related rhodopsins, will help overcome these challenges.

What control experiments should be included when studying Cruxrhodopsin-1's proton pumping activity?

Robust control experiments are essential for reliable characterization of Cruxrhodopsin-1:

  • Negative controls:

    • Empty liposomes/membranes without protein

    • Denatured/bleached Cruxrhodopsin-1 (retinal removed)

    • Dark conditions to control for non-light-dependent pH changes

  • Positive controls:

    • Well-characterized rhodopsin (e.g., bacteriorhodopsin) tested under identical conditions

    • Chemical calibration of the measurement system using known amounts of protons

  • Mechanism verification:

    • Protonophore addition (e.g., CCCP) to collapse proton gradients

    • Dicyclohexylcarbodiimide (DCCD) treatment to assess effect on proton pumping and ATP formation

    • Variation of external and internal pH to establish direction of proton movement

  • Spectroscopic controls:

    • Correlation between photocycle and proton pumping activity

    • Verification of functional protein by absorption spectrum before activity measurements

These controls help distinguish specific Cruxrhodopsin-1 activity from artifacts and allow quantitative comparison with other proton-pumping rhodopsins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.