Recombinant Haloarcula marismortui Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. Please specify your required tag type for prioritized development.
Synonyms
crcB2; rrnAC2253; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Target Names
crcB2
Target Protein Sequence
MVALESAHLVGAGGALGALCRHYLAGAIQRETFPLGTLTVNAFGSFALGLLTFAGVTGDA ALLVGVGACGSFTTFSSFSVETVRLWENGYVALAALNAVGNLACALVGIGLAWGIVRIV
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Haloarcula marismortui Protein CrcB Homolog 2?

CrcB homolog 2 (crcB2) is a putative fluoride ion transporter protein found in the archaeon Haloarcula marismortui. It shares structural and functional similarities with CrcB homolog 1 (crcB1), which consists of 127 amino acids and plays a significant role in ion transport across cell membranes . These proteins are critical components in the osmoadaptation strategies employed by this extremophile to survive in fluctuating salinity environments . The CrcB family proteins typically contain transmembrane domains that facilitate ion movement and contribute to maintaining cellular homeostasis in extreme conditions.

What expression systems are suitable for producing recombinant H. marismortui CrcB2?

E. coli expression systems are commonly used for the recombinant production of H. marismortui proteins, as demonstrated with the related CrcB1 protein . When expressing CrcB2, consider using the following approach:

  • Clone the full-length crcB2 gene into an expression vector with an N-terminal or C-terminal His-tag for purification purposes.

  • Transform the construct into an E. coli strain optimized for membrane protein expression (e.g., BL21(DE3), C41(DE3), or C43(DE3)).

  • Culture in LB or TB media supplemented with appropriate antibiotics.

  • Induce expression with IPTG at reduced temperatures (16-25°C) to enhance proper folding.

  • Extract and purify using immobilized metal affinity chromatography (IMAC) .

This approach has proven effective for the homologous CrcB1 protein and should be adaptable for CrcB2 with minor optimizations.

How should recombinant CrcB2 protein be stored and handled?

Based on protocols for the homologous CrcB1 protein, the following storage and handling recommendations apply:

ParameterRecommendation
Storage temperature-20°C to -80°C for long-term storage
Storage bufferTris/PBS-based buffer, pH 8.0 with 6% Trehalose
FormLyophilized powder or in solution with glycerol
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol content5-50% (final concentration) for aliquots
Handling noteBrief centrifugation recommended before opening
AvoidRepeated freeze-thaw cycles
Working aliquotsStore at 4°C for up to one week

These recommendations are derived from established protocols for CrcB1 and should be applicable to the homologous CrcB2 protein.

What is the function of CrcB proteins in Haloarcula marismortui?

CrcB proteins in H. marismortui function primarily as putative fluoride ion transporters and play crucial roles in ion homeostasis. These membrane proteins contribute to the organism's "salt-in" strategy of osmoadaptation, which involves maintaining high intracellular ion concentrations to balance external osmotic pressure . This mechanism is particularly important in hypersaline environments where salt concentrations fluctuate dramatically.

Research on related halophilic archaea shows that CrcB family proteins help regulate intracellular sequestration of K+ and Cl- ions in response to hypo- and hypersalinity conditions . This ion regulation is part of a complex cellular response that includes production of stress proteins (sHSP) and protective carotenoid pigments that enable survival in extreme salt conditions .

What experimental approaches are most effective for studying CrcB2 structure-function relationships?

To investigate structure-function relationships of CrcB2, implement a multi-faceted experimental approach:

  • X-ray Crystallography/Cryo-EM:

    • Purify CrcB2 to >95% homogeneity using multi-step chromatography

    • Screen crystallization conditions using sparse matrix approaches

    • Collect diffraction data at synchrotron facilities

    • Consider lipidic cubic phase crystallization for membrane proteins

  • Site-Directed Mutagenesis:

    • Target conserved residues identified through sequence alignment with CrcB1

    • Focus on the putative ion channel region and transmembrane domains

    • Generate alanine-scanning libraries to identify essential residues

  • Fluoride Transport Assays:

    • Reconstitute purified CrcB2 in liposomes

    • Use fluoride-selective electrodes or fluorescent probes to measure transport

    • Compare kinetics with CrcB1 to identify functional differences

  • Molecular Dynamics Simulations:

    • Build computational models based on homology with known structures

    • Simulate ion movement through the channel under various conditions

    • Identify key residues involved in selectivity and gating mechanisms

These approaches should be integrated to develop a comprehensive understanding of how structural elements contribute to CrcB2 function in extreme environments.

How do the expression patterns of CrcB2 change in response to environmental stressors?

The expression of membrane proteins like CrcB2 in H. marismortui demonstrates significant fluctuations in response to environmental stressors, particularly salinity changes. To investigate these patterns:

  • Quantitative Proteomics Approach:

    • Implement spectral count analysis to quantify protein expression changes

    • Compare mid-log and late-log phase proteomes to identify growth-phase dependent changes

    • Integrate network analyses to map affected biomodules

  • Monitoring Methods:

    • Use RT-qPCR to measure crcB2 mRNA expression levels

    • Employ western blotting with specific antibodies for protein quantification

    • Consider ribosome profiling to assess translational regulation

Research on H. marismortui has identified approximately 300 proteins that show expression changes in late-log phase, with about 106 metabolic proteins exhibiting growth-phase dependent changes . Similar methodologies can be applied to specifically investigate CrcB2 expression patterns under various stress conditions.

  • Expected Patterns:

    • Increased expression under hypersaline conditions to facilitate ion homeostasis

    • Co-regulation with other osmoadaptation proteins

    • Possible inverse correlation with expression of small heat shock proteins (sHSP)

What is the optimal experimental design for switchback experiments investigating CrcB2 function?

When designing switchback experiments to investigate CrcB2 function under varying conditions:

  • Design Considerations:

    • Implement a minimax discrete robust optimization approach

    • Account for carryover effects—the length of time a treatment persists in impacting outcomes

    • Establish structural parameters for optimal design via continuous relaxation

  • Experimental Implementation:

    • Alternate between different salt concentrations to assess CrcB2 functional responses

    • Incorporate appropriate control conditions (null treatments)

    • Include sufficient replicates to power statistical analyses

  • Statistical Analysis:

    • Apply both randomization-based p-values and finite population central limit theorem

    • Conduct conservative hypothesis tests and build confidence intervals

    • Account for potential misspecification of carryover effect order

This experimental design is particularly valuable for studying CrcB2 in dynamic environments that mimic the natural salinity fluctuations experienced by H. marismortui in solar salterns.

How can researchers distinguish between the specific functions of CrcB1 and CrcB2 homologs?

Distinguishing between the functions of CrcB1 and CrcB2 requires targeted comparative analyses:

  • Sequence-Structure Comparison:

    • Perform detailed sequence alignment to identify conserved and divergent regions

    • Generate structural models to highlight potential functional differences

    • Compare transmembrane topology predictions

  • Gene Knockout Studies:

    • Generate single knockouts (ΔcrcB1 or ΔcrcB2) and double knockouts (ΔcrcB1ΔcrcB2)

    • Assess growth phenotypes under varying salt concentrations

    • Measure intracellular ion concentrations using techniques like EDAX and ICP-AES

  • Complementation Assays:

    • Express each homolog in knockout strains to assess functional redundancy

    • Test cross-species complementation to evaluate evolutionary conservation

    • Measure restoration of growth and ion homeostasis

  • In vitro Transport Assays:

    • Purify both proteins and reconstitute in liposomes

    • Compare transport kinetics for various ions (F-, Cl-, etc.)

    • Assess inhibitor sensitivity profiles to identify functional distinctions

These approaches should provide clear evidence of functional overlap or divergence between the two homologs.

What purification protocol yields the highest activity for recombinant CrcB2?

A specialized purification protocol that preserves the native conformation and activity of CrcB2 includes:

StepProcedureBuffer CompositionNotes
1. Cell LysisSonication or French press50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitorsKeep samples cold throughout
2. Membrane ExtractionUltracentrifugation followed by detergent solubilizationAbove buffer + 1% DDM or LMNG detergentGentle solubilization at 4°C for 2-3 hours
3. IMACNi-NTA or TALON resinAbove buffer + 0.1% detergent + 20-250 mM imidazole gradientUse gravity flow or FPLC
4. Size ExclusionSuperdex 20020 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.05% detergentEnsures monodispersity
5. Concentration100 kDa MWCO concentratorSame as SEC bufferAvoid over-concentration

Key considerations for maintaining activity:

  • Keep the protein in mild detergents throughout purification

  • Include stabilizing agents (glycerol, specific lipids) in all buffers

  • Maintain a high salt concentration (150-300 mM) to mimic native conditions

  • Perform activity assays immediately after purification

How should researchers design experiments to study CrcB2's role in osmoadaptation?

To effectively study CrcB2's role in osmoadaptation:

  • Salinity Gradient Experiments:

    • Culture H. marismortui in media with varying NaCl concentrations (10-30%)

    • Monitor growth rates, cell morphology, and CrcB2 expression levels

    • Measure intracellular ion concentrations at each salinity level

  • Shock Response Studies:

    • Subject cultures to sudden shifts in salinity (both hypo- and hypersaline)

    • Track time-course expression of CrcB2 using qPCR and western blotting

    • Correlate with production of stress proteins and carotenoid pigments

  • Comparative Genomics Approach:

    • Analyze CrcB2 presence and sequence conservation across halophiles with different salt tolerances

    • Identify co-occurring genes that may function in the same pathway

    • Generate phylogenetic trees to understand evolutionary adaptations

  • Metabolic Network Analysis:

    • Map CrcB2 function within the context of connected metabolic reactions

    • Identify interactions with amino acid metabolism networks which are highly connected in H. marismortui

    • Predict systems fluctuations upon environmental stresses

This integrated approach will provide a comprehensive understanding of CrcB2's contribution to the remarkable salt adaptation capabilities of H. marismortui.

What analytical techniques are most appropriate for characterizing CrcB2 interactions with cellular components?

To characterize CrcB2 interactions with other cellular components:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies specific to CrcB2 or use anti-tag antibodies

    • Pull down CrcB2 along with interacting partners

    • Identify proteins by mass spectrometry

    • Validate key interactions with reciprocal Co-IP

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to intact cells

    • Purify CrcB2 complexes under denaturing conditions

    • Digest and analyze by LC-MS/MS

    • Map interaction sites at amino acid resolution

  • Fluorescence Microscopy Techniques:

    • Generate fluorescent protein fusions with CrcB2

    • Visualize subcellular localization and co-localization with potential partners

    • Apply FRET or FLIM to detect direct interactions in live cells

  • Membrane Protein-specific Methods:

    • Implement bimolecular fluorescence complementation (BiFC)

    • Use split-ubiquitin yeast two-hybrid systems designed for membrane proteins

    • Apply lipid nanodisc technology to study interactions in near-native environments

These techniques should be applied in combination to build a comprehensive interaction network for CrcB2.

How should researchers interpret conflicting results in CrcB2 functional studies?

When facing conflicting results in CrcB2 functional studies:

  • Systematic Evaluation Framework:

    • Compare experimental conditions (pH, temperature, salt concentration)

    • Assess protein preparation methods and verify protein integrity

    • Evaluate expression systems and potential effects of tags or fusion partners

    • Consider cell-specific factors that might influence results

  • Statistical Approach:

    • Implement robust statistical methods including null and alternative hypotheses testing

    • Apply both randomization-based p-values and conservative hypothesis tests

    • Build confidence intervals using finite population central limit theorem

    • Consider meta-analysis approaches to integrate disparate datasets

  • Validation Strategies:

    • Reproduce key experiments using alternative methodologies

    • Verify results across different model systems

    • Apply complementary techniques to measure the same parameters

    • Collaborate with independent laboratories for external validation

  • Computational Integration:

    • Develop mathematical models that might explain seemingly contradictory results

    • Use molecular dynamics simulations to test hypotheses about conflicting functional data

    • Apply machine learning approaches to identify patterns in complex datasets

Remember that apparent contradictions often reveal new biological insights about protein function under different conditions.

What bioinformatics approaches are most valuable for predicting CrcB2 structure and function?

For predicting CrcB2 structure and function, employ these bioinformatics approaches:

  • Homology Modeling:

    • Use the CrcB1 sequence as a template if available

    • Leverage structures of related fluoride channels from other organisms

    • Apply multiple modeling algorithms (SWISS-MODEL, I-TASSER, AlphaFold2) and compare results

    • Validate models using energy minimization and Ramachandran plot analysis

  • Functional Domain Prediction:

    • Identify conserved domains using InterPro, Pfam, and CDD

    • Map transmembrane regions using TMHMM, Phobius, or MEMSAT

    • Predict ion-binding sites based on electrostatic potential calculations

    • Locate post-translational modification sites using ELM or NetPhos

  • Molecular Dynamics Simulations:

    • Embed predicted structures in virtual lipid bilayers

    • Simulate ion transport under various osmotic conditions

    • Calculate free energy profiles for ion permeation

    • Identify key residues involved in selectivity and gating

  • Network Analysis:

    • Integrate CrcB2 into protein-protein interaction networks

    • Predict functional associations using STRING or GeneMANIA

    • Connect to metabolic pathways using KEGG or MetaCyc

    • Identify co-expressed genes through transcriptomic data mining

These approaches provide complementary insights that together form a comprehensive prediction of CrcB2 structure and function.

What emerging technologies hold promise for advancing CrcB2 research?

Several cutting-edge technologies show particular promise for CrcB2 research:

  • Cryo-Electron Microscopy:

    • Single particle analysis for high-resolution structure determination

    • Tomography for visualizing CrcB2 in cellular context

    • Time-resolved cryo-EM to capture dynamic conformational changes

  • Advanced Microscopy Techniques:

    • Super-resolution microscopy for precise localization studies

    • Single-molecule FRET to monitor conformational dynamics

    • Correlative light and electron microscopy (CLEM) to connect function to structure

  • Genome Editing in Extremophiles:

    • CRISPR-Cas systems optimized for halophilic archaea

    • Precise genome editing to create point mutations in crcB2

    • Creation of reporter fusions at endogenous loci

  • Integrative Multi-omics:

    • Combining proteomics, transcriptomics, and metabolomics

    • Systems-level analysis of CrcB2 function in osmoadaptation networks

    • Machine learning approaches to predict responses to environmental stressors

These technologies will allow researchers to address currently intractable questions about CrcB2 structure, function, and regulation in extreme environments.

How might CrcB2 research inform our understanding of evolutionary adaptations to extreme environments?

CrcB2 research provides valuable insights into evolutionary adaptations:

  • Molecular Evolution Perspectives:

    • Comparing CrcB homologs across archaea, bacteria, and eukarya reveals convergent adaptation strategies

    • Analyzing sequence conservation patterns identifies crucial functional elements

    • Reconstructing the evolutionary history of ion channels illuminates key adaptive events

  • Functional Adaptation Mechanisms:

    • Understanding how CrcB2 contributes to the "salt-in" strategy provides insights into fundamental osmoadaptation mechanisms

    • Identifying how protein structure adapts to function in high salt concentrations reveals principles of protein stability

    • Connecting ion transport to broader cellular networks demonstrates integrated stress responses

  • Ecological Implications:

    • CrcB2 function relates directly to niche adaptation in hypersaline environments

    • Comparing CrcB proteins across species from different saline environments reveals habitat-specific adaptations

    • Understanding these mechanisms helps predict microbial community responses to environmental changes

This research contributes to our fundamental understanding of life's adaptability and provides insights that may inform synthetic biology approaches for engineering organisms with enhanced stress tolerance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.