Recombinant Haloarcula marismortui Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Haloarcula marismortui Undecaprenyl-diphosphatase (uppP)

Undecaprenyl-diphosphatase (uppP) is an integral membrane enzyme critical for bacterial cell wall synthesis. In Haloarcula marismortui, a halophilic archaeon, this enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a carrier lipid essential for peptidoglycan and glycan biosynthesis . While bacterial uppP enzymes are well-studied (e.g., E. coli), the recombinant production and functional characterization of H. marismortui uppP remain emerging areas of research.

Enzymatic Function and Biochemical Role

Core Activity:

ParameterDescription
SubstrateUndecaprenyl pyrophosphate (UPP)
ProductUndecaprenyl phosphate (UP) + inorganic phosphate (Pi)
Role in Cell WallUP serves as a lipid carrier for peptidoglycan precursors (Lipid I/II) .
Catalytic CycleDephosphorylation enables UP recycling, sustaining glycan polymerization .

Divergence in Halophiles:
Unlike Gram-negative bacteria, H. marismortui likely employs distinct pathways for UP synthesis due to its halophilic adaptations. While bacterial uppP homologs (e.g., BacA) are well-characterized , H. marismortui uppP’s salt tolerance and structural features remain understudied.

Recombinant Production and Expression Systems

Key Methodologies:

FeatureDetail
Host OrganismEscherichia coli (e.g., BL21(DE3))
Fusion PartnerMutated bacteriorhodopsin (HmBRI/D94N) for enhanced membrane protein expression .
Purification TagsHis-tag for affinity chromatography; protease cleavage sites for tag removal .
Yield EnhancementSignificant improvement in membrane protein production through fusion systems .

Challenges:

  • Native lipid environments absent in E. coli may alter enzyme folding or activity.

  • Limited kinetic data (e.g., k<sub>cat</sub>/K<sub>m</sub> values) for H. marismortui uppP.

Research Applications and Functional Studies

Biotechnological Utility:

ApplicationDetail
Membrane Protein ProductionServes as a fusion partner to enhance solubility and yield of integral membrane proteins (e.g., carnitine/butyrobetaine antiporter) .
Peptidoglycan SynthesisTarget for antibiotics disrupting cell wall assembly .
Halophilic Enzyme EngineeringPotential for developing salt-resistant enzymes in biocatalysis.

Experimental Findings:

  • Recombinant uppP coexpression in H. hispanica PHB-1 restored PHB synthesis, highlighting its role in metabolic pathways .

  • Fusion systems using H. marismortui proteins (e.g., HmBRI) enable scalable production of membrane-bound enzymes .

Comparative Analysis with Bacterial Homologs

FeatureH. marismortui uppPE. coli UppP
Substrate SpecificityUndecaprenyl pyrophosphate (UPP)Undecaprenyl pyrophosphate (UPP)
Active Site Motifs(E/Q)XXXE, PGXSRSXXT (inferred)(E/Q)XXXE, PGXSRSXXT
Salt ToleranceAdapted to high NaCl environmentsLimited salt resistance
Kinetic DataNot reportedk<sub>cat</sub>/K<sub>m</sub> = 58.7 U/mg (NADP<sup>+</sup>)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requirements in your order notes, and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution, storing at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
uppP; bacA; rrnAC3219; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Target Names
uppP
Target Protein Sequence
MNPILVAILLGLLQGVLEWIPVSSEGGVALASTVVTGVSPAASTRLALFLHAGTAVAATA YYRTEVRTILHSIRQLSRRPFADETADLSFIVIATAATAVTGLPAYMVLDAAVSELEGGL FLALVGGLLVITGLLQRFAAALSLGEREIPDGFDAVLVGVLQGLAILPGVSRSGTTVSAL LLRGHEGESSLRLSFLLSIPAALAANVLVLVDDGIPAIEPLPAVVALIVSAVVGYLTVDA LVRLVRQVPFWAVCTVFGGLGVVGGLLVAL
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial cell wall synthesis?

Undecaprenyl pyrophosphate phosphatase (UppP) is an integral membrane protein that catalyzes the critical dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate. This reaction represents an essential step in bacterial cell wall synthesis, as undecaprenyl phosphate serves as an indispensable carrier lipid in peptidoglycan biosynthesis. The enzyme functions within the bacterial membrane, where it helps maintain the recycling of the lipid carrier necessary for cell wall component transport across the membrane.

The process begins with the synthesis of farnesyl diphosphate (FPP) from isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), catalyzed by farnesyl diphosphate synthase (FPPS). FPP subsequently condenses with eight additional IPP molecules to form undecaprenyl diphosphate (UPP) through the action of undecaprenyl diphosphate synthase (UPPS). UppP then converts UPP to undecaprenyl phosphate (UP), completing a critical step in the pathway.

How does the Haloarcula marismortui bacteriorhodopsin fusion system enhance uppP research?

The Haloarcula marismortui bacteriorhodopsin fusion system represents a significant methodological advancement for studying uppP. Researchers have created a fusion hybrid of Escherichia coli UPPP with Haloarcula marismortui bacteriorhodopsin that maintains catalytic activity in detergent-based assays. This fusion construct overcomes the inherent challenges of working with membrane proteins by enhancing stability and solubility while preserving enzymatic function.

The fusion system enables reliable activity measurements in standard biochemical assays, which is particularly valuable for inhibitor screening and mechanistic studies. This approach has facilitated determination that bacitracin inhibits the fusion protein with an IC50 of 32 μM, providing a useful positive control for inhibition studies. The system's robustness makes it an excellent tool for investigating structure-function relationships in uppP enzymes.

What are the key structural features of the uppP enzyme active site?

The enzyme active site of uppP has been characterized through a combination of computational modeling, molecular dynamics simulations, and site-directed mutagenesis experiments. Two critical consensus motifs form the foundation of the active site: the (E/Q)XXXE motif and the PGXSRSXXT motif. Additionally, a conserved histidine residue plays an essential role in the catalytic mechanism.

Studies propose that the active site is located in the periplasmic region of the enzyme. This positioning is significant for the enzyme's function, as it allows access to the pyrophosphate group of the substrate while the undecaprenyl chain remains embedded in the membrane. The spatial arrangement of these conserved residues creates a microenvironment conducive to the dephosphorylation reaction, with specific amino acids facilitating substrate binding and catalysis.

How should researchers design initial screening experiments for uppP activity?

When designing initial screening experiments for uppP activity, researchers should follow a systematic approach that begins with clearly defining the experimental objectives. Whether the goal is to characterize enzymatic properties, screen potential inhibitors, or investigate structure-function relationships, these objectives will guide subsequent experimental decisions.

For effective screening, consider the following structured approach:

  • Define the specific parameters to be measured (e.g., phosphatase activity, inhibition potency)

  • Select appropriate assay conditions (pH, temperature, detergent concentration)

  • Establish reliable controls (positive, negative, and vehicle)

  • Determine the range of conditions to test

  • Use statistical design principles to minimize runs while maximizing information

Screening experiments are particularly valuable early in the research process when many factors may influence enzyme activity. These experiments help identify which variables significantly impact uppP function, allowing subsequent studies to focus on optimizing these critical parameters.

What methods are most effective for measuring uppP enzyme activity in vitro?

Several methodological approaches have proven effective for measuring uppP enzyme activity in vitro, each with specific advantages depending on research objectives. The most reliable methods include:

Phosphate release assays: These assays quantify the inorganic phosphate released during the dephosphorylation reaction. Colorimetric methods using malachite green or other phosphate-binding dyes provide sensitive detection of enzymatic activity. When implementing this approach, researchers should carefully control background phosphate levels and include appropriate enzyme-free controls.

Detergent-based reconstitution systems: Since uppP is a membrane protein, detergent-based assays using the fusion hybrid of E. coli UPPP with Haloarcula marismortui bacteriorhodopsin have proven particularly effective. This system allows for stable enzyme activity measurement while maintaining the protein in a near-native environment. The choice of detergent is critical, as it must solubilize the enzyme while preserving its structural integrity and activity.

The following table summarizes key considerations for uppP activity assays:

Assay ParameterRecommendationRationale
Buffer composition50 mM Tris-HCl, pH 7.5, 150 mM NaClMaintains physiological conditions while stabilizing enzyme
Detergent0.1-0.5% DDM or similarSolubilizes membrane protein without denaturing
Substrate concentration5-50 μM undecaprenyl pyrophosphateSpans typical Km range
Temperature30-37°CReflects physiological conditions
Positive controlBacitracin (IC50 = 32 μM)Established inhibitor for validation

How can researchers effectively design experiments to address contradictions in uppP activity data?

When confronted with contradictory data regarding uppP activity, researchers should implement a systematic troubleshooting approach. Begin by thoroughly examining the data to identify specific discrepancies and patterns that contradict the initial hypothesis. This critical analysis should include close attention to outliers that may have influenced the results.

Following identification of contradictions, implement this structured approach:

  • Evaluate initial assumptions and experimental design for potential biases or limitations

  • Consider alternative explanations for the contradictory data, including enzyme stability issues, substrate quality, or assay interference

  • Modify data collection processes if necessary, potentially implementing more sensitive or specific detection methods

  • Refine variables by implementing additional controls to isolate the source of variability

  • Design validation experiments specifically targeting the contradictory results

This methodical approach allows researchers to gain valuable insights from unexpected results rather than dismissing them. Remember that contradictory data often leads to new discoveries and deeper understanding of enzymatic mechanisms.

How does the bacterial environment affect uppP activity and what implications does this have for inhibitor development?

The bacterial membrane environment significantly influences uppP activity through several mechanisms that must be considered in inhibitor development. The lipid composition, particularly the presence of negatively charged phospholipids, can modulate enzyme conformation and substrate accessibility. Additionally, the proton gradient across the membrane may influence the protonation state of key catalytic residues in the (E/Q)XXXE and PGXSRSXXT motifs.

Research suggests that the enzyme's active site is positioned in the periplasm, creating opportunities for inhibitor design that target this specific cellular compartment. This positioning has several implications for inhibitor development:

  • Inhibitors must navigate the outer membrane of Gram-negative bacteria or the cell wall of Gram-positive bacteria

  • Compounds targeting the active site need appropriate physiochemical properties to reach the periplasmic space

  • Inhibitors should maintain stability and activity in the ionic environment of the periplasm

Effective inhibitors like bacitracin demonstrate that disrupting the UppP function represents a viable antibacterial strategy. The fusion system of E. coli UPPP with Haloarcula marismortui bacteriorhodopsin provides an excellent platform for screening potential inhibitors in conditions that better approximate the native enzyme environment.

What methodological approaches can be used to investigate the structure-function relationships of recombinant Haloarcula marismortui uppP?

Investigating structure-function relationships of recombinant Haloarcula marismortui uppP requires integrating multiple experimental approaches. The fusion hybrid with bacteriorhodopsin serves as an excellent starting point, as it maintains enzyme activity while improving protein stability and expression.

The following methodological approaches prove particularly valuable:

Site-directed mutagenesis: Systematically altering conserved residues in the (E/Q)XXXE and PGXSRSXXT motifs, as well as the essential histidine, can reveal their specific contributions to substrate binding and catalysis. Each mutant should be characterized for expression, stability, and enzymatic activity.

Molecular dynamics simulations: Computational modeling can predict conformational changes during catalysis and identify potential binding sites for substrates and inhibitors. This approach is particularly useful when combined with experimental validation of computational predictions.

Biochemical characterization with substrate analogs: Using synthetic substrate analogs with modifications at specific positions can reveal substrate recognition determinants and catalytic mechanism details. This approach can identify which chemical features are essential for substrate binding versus catalysis.

When implementing these approaches, researchers should consider:

  • Using consistent expression and purification protocols across all mutants

  • Including appropriate wild-type controls in each experiment

  • Implementing multiple activity assays to confirm findings

  • Validating structural predictions with experimental data

What are the most effective strategies for optimizing expression and purification of recombinant Haloarcula marismortui uppP?

Optimizing expression and purification of recombinant Haloarcula marismortui uppP requires addressing the challenges inherent to membrane proteins. The fusion with bacteriorhodopsin represents an excellent strategy, but additional optimization steps can further improve yield and activity.

An effective optimization workflow should include:

Expression system selection: E. coli C41(DE3) or C43(DE3) strains are often preferred for membrane protein expression as they better tolerate the metabolic burden. Consider using a tightly controlled induction system to prevent toxicity from overexpression.

Culture conditions optimization: Adjusting induction parameters (temperature, inducer concentration, and induction time) can significantly impact protein yield and folding. Generally, lower temperatures (16-25°C) and longer induction times improve membrane protein folding.

Purification strategy refinement: For the fusion construct, immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography yields the purest preparations. Critical factors include:

  • Detergent selection for solubilization and purification

  • Buffer composition to maintain enzyme stability

  • Addition of lipids during purification to preserve activity

The following table presents optimized conditions for uppP expression and purification:

ParameterOptimized ConditionCritical Consideration
Expression strainE. coli C41(DE3)Better tolerates membrane protein expression
Induction0.1-0.5 mM IPTG, 18°C, 16-20hSlower expression improves folding
Solubilization1% DDM, 4 hours, 4°CComplete solubilization without denaturation
IMAC50 mM Tris pH 7.5, 300 mM NaCl, 0.05% DDMHigher salt reduces non-specific binding
Storage10% glycerol, -80°CPrevents freeze-thaw damage

How should researchers approach contradictory data when studying uppP inhibition?

When confronted with contradictory data during uppP inhibition studies, researchers should implement a systematic analytical approach. First, thoroughly examine all experimental data to identify specific discrepancies between expected and observed results. This should include careful review of experimental conditions, enzyme preparation quality, and assay components.

To resolve contradictions effectively:

  • Verify the integrity and activity of both enzyme and substrate preparations

  • Consider potential interference from assay components or compound solubility issues

  • Examine dose-response curves for irregularities that might indicate multiple binding sites or complex inhibition mechanisms

  • Implement alternative assay formats to confirm initial findings

  • Consider whether apparent contradictions might reveal novel mechanistic insights

Remember that unexpected results often lead to significant discoveries. For example, if an inhibitor shows differential effects under varying conditions, this might reveal condition-dependent conformational changes in the enzyme. Approach contradictions as opportunities to deepen understanding rather than experimental failures.

What statistical approaches are most appropriate for analyzing uppP enzyme kinetics data?

Recommended statistical approaches include:

For basic kinetic parameters (Km, Vmax):

  • Non-linear regression using enzyme kinetics software (GraphPad Prism, Origin, etc.)

  • Weighting options to account for heteroscedasticity in enzymatic data

  • Comparison of different enzyme models (Michaelis-Menten vs. Hill equation) using AIC or F-test

For inhibitor studies:

  • IC50 determination through four-parameter logistic regression

  • Mechanism of inhibition determination through global fitting of multiple substrate-velocity curves

  • Statistical comparison of inhibition models using extra sum-of-squares F-test

When designing experiments for statistical analysis, ensure:

  • Sufficient data points across the substrate or inhibitor concentration range

  • Appropriate replicates (minimum triplicate measurements)

  • Inclusion of controls in each experimental set

  • Consistent experimental conditions across comparisons

What are the most effective methods for validating computational models of uppP structure and function?

Validating computational models of uppP structure and function requires integrating in silico predictions with experimental data. This multi-faceted approach ensures that computational models accurately represent the biological reality of the enzyme.

Effective validation methods include:

Structure-based validation:

  • Site-directed mutagenesis of predicted key residues

  • Biochemical characterization of mutants to confirm the predicted roles of specific amino acids

  • Comparison of experimental enzyme kinetics with computational predictions

Inhibitor-based validation:

  • Testing computational docking predictions with experimental binding assays

  • Structure-activity relationship studies to confirm binding mode predictions

  • Resistance mutation analysis to identify actual inhibitor binding sites

Dynamic behavior validation:

  • Hydrogen-deuterium exchange mass spectrometry to assess predicted flexible regions

  • Limited proteolysis experiments to identify exposed areas of the protein

  • Disulfide cross-linking studies to validate predicted residue proximities

When implementing these validation approaches, researchers should maintain consistent experimental conditions and include appropriate controls. The fusion hybrid of E. coli UPPP with Haloarcula marismortui bacteriorhodopsin provides an excellent experimental system for these validation studies.

How might recent advances in membrane protein structural biology be applied to uppP research?

Recent advances in membrane protein structural biology offer tremendous potential for advancing uppP research. Cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structure determination, potentially allowing visualization of uppP in different conformational states during catalysis. This technique, combined with the fusion hybrid system, could reveal unprecedented structural details.

Applying these advances requires:

  • Optimization of the fusion construct for structural studies, potentially including additional stabilizing mutations

  • Reconstitution in nanodiscs or lipid nanodiscs for near-native environment structural studies

  • Implementation of time-resolved techniques to capture catalytic intermediates

  • Integration of computational methods with experimental structural data

Additionally, advances in native mass spectrometry now allow analysis of intact membrane protein complexes with bound lipids or substrates. This approach could provide insights into how uppP interacts with its undecaprenyl pyrophosphate substrate in a native-like environment.

What strategies can researchers employ to develop selective inhibitors of Haloarcula marismortui uppP?

Developing selective inhibitors of Haloarcula marismortui uppP requires a multifaceted approach that leverages both structural understanding and activity screening. The fusion hybrid system provides an excellent platform for inhibitor screening, while computational approaches can guide rational inhibitor design.

Effective strategies include:

Structure-based design:

  • Use computational modeling to identify unique features of the Haloarcula marismortui uppP active site

  • Design compounds that exploit these unique features for selectivity

  • Implement molecular dynamics simulations to assess binding stability and specificity

Fragment-based screening:

  • Screen libraries of low-molecular-weight fragments for binding to uppP

  • Grow or link fragments that bind to different regions of the enzyme

  • Optimize resulting compounds for potency and selectivity

Natural product exploration:

  • Screen natural product libraries, particularly those from extreme environments

  • Investigate structural features of known inhibitors like bacitracin

  • Develop semi-synthetic derivatives with improved properties

The development pipeline should include counter-screening against related phosphatases to ensure selectivity and assessment of activity in both biochemical assays and cellular systems. Bacitracin serves as a useful positive control with its established IC50 of 32 μM.

How might understanding uppP function contribute to developing novel antibacterial strategies?

Understanding uppP function offers significant potential for developing novel antibacterial strategies, as this enzyme catalyzes an essential step in bacterial cell wall synthesis. Since humans lack this pathway, inhibitors targeting uppP potentially offer selective toxicity against bacteria.

Promising research directions include:

  • Combination approaches that simultaneously target multiple steps in the undecaprenyl phosphate cycle, potentially including both UPPS and uppP inhibitors

  • Development of prodrugs that are activated specifically in the bacterial periplasm

  • Creation of hybrid molecules that target both uppP and other cell wall biosynthesis enzymes

  • Investigation of synergistic effects between uppP inhibitors and existing antibiotics

The fusion hybrid of E. coli UPPP with Haloarcula marismortui bacteriorhodopsin provides an excellent platform for screening potential inhibitors. Recent high-throughput screening efforts have identified several promising scaffolds, including tetramic/tetronic acids, diamidines, and benzoic acids that inhibit this pathway.

Understanding the structural basis of uppP function, particularly the roles of the conserved (E/Q)XXXE and PGXSRSXXT motifs, can guide rational drug design efforts targeting this essential bacterial enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.