Recombinant Haloarcula sp. Cruxrhodopsin-2 (cop2)

Shipped with Ice Packs
In Stock

Description

Table 1: Sequence Identity Comparison with Microbial Rhodopsins

ProteinIdentity to Cruxrhodopsin-2Key Conserved Features
Cruxrhodopsin-177%Proton-pumping charged residues
Bacteriorhodopsin50%Retinal-binding Lys residue
Archaerhodopsin-1/248%Transmembrane helix arrangement

The protein retains critical charged residues (e.g., Asp85, Asp96) essential for proton transport . Its low natural abundance (0.05 nmol/mg protein in Haloarcula arg-2) contrasts with bacteriorhodopsin levels in Halobacterium salinarium .

Biochemical Properties

Cruxrhodopsin-2 operates under anaerobic conditions, coupling light absorption to proton extrusion and ATP synthesis :

Table 2: Key Functional Metrics

ParameterValueExperimental Conditions
Light-induced ΔATPConcomitant with proton extrusionAnaerobic, 520 nm light exposure
H+/ATP Stoichiometry>3Dicyclohexylcarbodiimide (DCCD) inhibition assay
Proton Extrusion RateEnhanced by DCCDpH 7.0, 25°C

DCCD inhibits ATP formation while accelerating proton extrusion, indicating mechanistic parallels with F-type ATPases .

Research Applications

  • Optogenetic Studies: As a light-gated proton channel, it serves as a tool for manipulating cellular pH or ATP levels in synthetic biology .

  • Structural Biology: Sequence divergence from bacteriorhodopsin provides insights into proton pump evolution .

  • Biotechnological Reagents: Commercial availability (e.g., CSB-CF709584HBAY) supports ELISA and transmembrane protein studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cop2; Cruxrhodopsin-2; COP-2; CR-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Haloarcula sp. (strain arg-2 / Andes heights)
Target Names
cop2
Target Protein Sequence
MLQSGMSTYVPGGESIFLWVGTAGMFLGMLYFIARGWSVSDQRRQKFYIATIMIAAIAFV NYLSMALGFGVTTIELGGEERAIYWARYTDWLFTTPLLLYDLALLAGADRNTIYSLVGLD VLMIGTGALATLSAGSGVLPAGAERLVWWGISTGFLLVLLYFLFSNLTDRASELSGDLQS KFSTLRNLVLVLWLVYPVLWLVGTEGLGLVGLPIETAAFMVLDLTAKIGFGIILLQSHAV LDEGQTASEGAAVAD
Uniprot No.

Target Background

Function
Light-driven proton pump. May generate a protonmotive force sufficient to synthesize ATP in the light.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cruxrhodopsin-2 and what is its function in Haloarcula species?

Cruxrhodopsin-2 (cop2) is a light-driven proton pump found in Haloarcula sp. arg-2, a natural bacterial isolate from Andes heights. Unlike some other archaeal rhodopsins, it functions exclusively as a proton pump without light-driven anion pump capabilities. The protein plays a crucial role in the bioenergetic processes of these extremophilic archaea, allowing them to convert light energy into a proton gradient that can be utilized for ATP synthesis. This photo-induced proton translocation occurs across the cell membrane and represents a specialized adaptation to the high-salt environments where these organisms typically thrive .

When examining cop2's role in cellular energetics, it's important to note that under anaerobic conditions, Haloarcula sp. arg-2 exhibits light-induced proton extrusion that coincides with increased ATP levels without the transient proton uptake observed in other species. This distinctive characteristic suggests a unique mechanism of energy conversion that differentiates cop2 from other archaeal rhodopsins .

How does Cruxrhodopsin-2 compare to other archaeal rhodopsins?

Cruxrhodopsin-2 belongs to the archaeal rhodopsin family but possesses several distinguishing characteristics:

PropertyCruxrhodopsin-2BacteriorhodopsinCruxrhodopsin-1Archaerhodopsin-1/-2
Sequence identity to cop2100%50%77%48%
Molecular mass27,544 Da~26,000 DaSimilar to cop2Similar to cop2
Expression level0.05 nmol/mg protein20-30 fold higherVariableVariable
Proton uptakeNo transient uptakeShows transient uptakeVariableVariable
H+/ATP stoichiometry>3~3Not specifiedNot specified

A key functional difference is that Cruxrhodopsin-2 in Haloarcula sp. arg-2 is present at significantly lower concentrations (0.05 nmol/mg protein) compared to bacteriorhodopsin in Halobacterium salinarium R1M1, which is 20-30 fold higher. Despite this lower expression, cop2 maintains effective proton pumping capabilities. Additionally, unlike bacteriorhodopsin systems, cop2-containing cells show light-induced proton extrusion with ATP level increases without the transient proton uptake observed in other systems .

What are the optimal conditions for expressing recombinant Cruxrhodopsin-2?

The expression of recombinant Cruxrhodopsin-2 requires careful optimization of several parameters. Based on studies with similar archaeal rhodopsins, researchers have established effective methodologies for cop2 expression:

For E. coli-based expression systems (similar to those used for related proteins like Cruxrhodopsin-3):

  • Expression vector selection: pET-based vectors with His-tag fusion for simplified purification

  • E. coli strain selection: C41(DE3) or C43(DE3) strains are preferable as they tolerate membrane protein expression better than standard BL21(DE3)

  • Induction conditions: 0.5 mM IPTG at OD600 of 0.6-0.8

  • Post-induction growth: Reduce temperature to 20-25°C and continue for 18-24 hours

  • Supplementation: Add all-trans retinal (10 μM) at the time of induction to ensure proper chromophore incorporation

For expression in native-like halophilic systems:

  • Medium composition: High-salt medium (3-4 M NaCl) supplemented with yeast extract (0.2% w/v) and KH2PO4 (0.004% w/v)

  • Growth conditions: 42°C with shaking (120 rpm)

  • Light conditions: Controlled illumination cycles to optimize expression

  • pH maintenance: Buffer at pH 7.2-7.5 throughout growth

The recombinant protein should be stored in Tris-based buffer with 50% glycerol at pH 8.0 for optimal stability. For long-term storage, maintain at -20°C/-80°C, and avoid repeated freeze-thaw cycles as these significantly reduce protein activity .

What purification methods are most effective for Cruxrhodopsin-2?

Purification of recombinant Cruxrhodopsin-2 requires a multi-step approach to obtain high purity protein while maintaining functional integrity:

  • Cell Lysis and Membrane Extraction:

    • Resuspend cells in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl

    • Disrupt cells via sonication or French press

    • Collect membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize membrane proteins with n-dodecyl-β-D-maltoside (DDM) at 1% concentration

  • Affinity Chromatography (for His-tagged proteins):

    • Use Ni-NTA resin equilibrated with buffer containing 0.05% DDM

    • Wash with increasing imidazole concentrations (10-40 mM)

    • Elute with 250-300 mM imidazole

  • Size Exclusion Chromatography:

    • Apply eluted protein to Superdex 200 column

    • Use running buffer containing 20 mM HEPES (pH 7.5), 150 mM NaCl, and 0.05% DDM

  • Quality Assessment:

    • Confirm purity by SDS-PAGE (>90% purity is typically achievable)

    • Verify functionality through absorption spectroscopy (characteristic absorption peak)

    • Assess protein homogeneity by dynamic light scattering

The purified protein should maintain its characteristic reddish-purple color, indicating proper retinal binding and protein folding. For applications requiring extremely high purity, ion exchange chromatography can be added as an intermediate step between affinity and size exclusion chromatography .

How can Cruxrhodopsin-2 be utilized in artificial retina and nanoelectronic device development?

Cruxrhodopsin-2, like other archaeal rhodopsins, demonstrates significant potential for application in bioelectronic interfaces and artificial vision systems. The implementation of cop2 in these technologies leverages its inherent photoelectric properties and exceptional stability:

For artificial retina applications:

  • Biomimetic Photodetectors: cop2 can be integrated into lipid bilayers or polymer matrices to create light-sensitive elements that generate electrical signals upon illumination. The natural proton-pumping activity of cop2 provides a direct mechanism for converting photons to electrical signals, similar to natural photoreceptors .

  • Signal Transduction Mechanisms: When cop2 is oriented correctly in an artificial membrane, the light-induced proton gradient can be coupled to electrode surfaces through various transduction mechanisms:

    • Direct electrical coupling via conductive polymers

    • Indirect coupling through pH-sensitive materials

    • Integration with semiconductor interfaces

  • Stability Enhancement: cop2's exceptional stability in harsh conditions makes it particularly valuable for long-term implantable devices. Research suggests that cop2-based biophotonic elements retain functionality longer than mammalian rhodopsin-based alternatives .

For nanoelectronic applications:

  • Molecular Memory Elements: Using the photocycle states of cop2 as binary information carriers

  • Photoelectric Switches: Creating light-controlled electrical elements with nanoscale dimensions

  • Biosensors: Developing sensors that transduce biochemical signals into optical or electrical outputs

Recent experimental approaches have demonstrated success in patterning cop2 onto silicon surfaces using lithographic techniques, allowing precise spatial control of the protein for integrated device fabrication. The photocycle kinetics of cop2 (which are distinct from bacteriorhodopsin) offer unique switching properties that can be exploited for specific applications requiring distinctive response characteristics .

What spectroscopic properties distinguish Cruxrhodopsin-2, and how can they be experimentally characterized?

Cruxrhodopsin-2 exhibits distinctive spectroscopic properties that can be leveraged for both basic characterization and applied research. These properties stem from its retinal chromophore and protein environment:

Absorption Spectroscopy Characteristics:

  • While specific data for cop2 absorption maxima vary slightly between preparations, it typically shows absorption maxima in the visible range

  • The protein exhibits pH-dependent spectral shifts, similar to other cruxrhodopsins

  • The chromophore absorption is sensitive to the protein's conformational state during its photocycle

Experimental Characterization Methods:

  • Steady-State Absorption Spectroscopy:

    • Use UV-Vis spectrophotometer to record spectra between 250-700 nm

    • Monitor absorption maxima as function of pH (typically between pH 4-9)

    • Compare spectra of dark-adapted versus light-adapted states

  • Flash Photolysis for Photocycle Analysis:

    • Use pulsed laser excitation (typically 532 nm) followed by time-resolved spectroscopy

    • Monitor transient spectral changes over timescales from microseconds to seconds

    • Identify and characterize photointermediates (similar to the K, L, M, N, O intermediates in bacteriorhodopsin)

  • Resonance Raman Spectroscopy:

    • Provides information about retinal configuration and protein-chromophore interactions

    • Excite samples with wavelengths corresponding to absorption maxima

    • Analyze vibrational modes characteristic of retinal in different states

  • Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure content and protein folding

    • Monitor thermal stability through temperature-dependent CD measurements

    • Compare native and recombinant protein conformations

An example experimental setup for photocycle analysis would include:

  • Sample preparation: Purified cop2 (1-2 mg/ml) in buffer containing 50 mM phosphate, 150 mM NaCl, pH 7.0

  • Instrumentation: Laser flash photolysis system with xenon arc lamp probe

  • Data collection: Kinetic traces at multiple wavelengths (400, 450, 550, 600 nm)

  • Analysis: Global fitting of spectral data to extract photocycle intermediate lifetimes and spectra

These spectroscopic methods provide essential information about cop2's functional mechanism and can guide genetic engineering efforts to modify its properties for specific applications .

How does the photocycle of Cruxrhodopsin-2 compare with other microbial rhodopsins, and what implications does this have for optogenetic applications?

The photocycle of Cruxrhodopsin-2 represents its functional core, defining how the protein responds to light and performs its biological role. While detailed photocycle data specific to cop2 is somewhat limited in the provided sources, we can draw significant inferences from related proteins:

Photocycle Comparison:

Photocycle PropertyCruxrhodopsin-2BacteriorhodopsinChannelrhodopsinsImplications
Photocycle durationSimilar to bacteriorhodopsin but with unique kinetics~10 ms~20-30 msDefines temporal resolution of optogenetic control
Key intermediatesIncludes distinctive P600 and P500 statesK, L, M, N, O intermediatesP520, P390 statesDetermines spectral sensitivity during cycle
Recovery kineticsFaster recovery than channelrhodopsinsModerate recoverySlower recoveryAffects frequency of activation possible
Ion specificityProton-specificProton-specificCation non-specificDetermines cellular effects when expressed

Methodological Approaches for Photocycle Characterization:

  • Time-Resolved Spectroscopy:

    • Nanosecond laser flash photolysis to monitor formation and decay of photointermediates

    • Tracking absorption changes at characteristic wavelengths of intermediates

    • Mathematical modeling to extract kinetic constants for each transition

  • Electrophysiological Measurements:

    • Patch-clamp recordings of cells expressing cop2

    • Correlation of current generation with photocycle kinetics

    • Determination of ion selectivity and conductance properties

Optogenetic Applications and Considerations:

The unique photocycle characteristics of cop2 suggest several potential advantages for optogenetic applications:

  • Spectral Tuning: The distinctive absorption properties of cop2 could allow multiplexed optogenetic control when used alongside other channelrhodopsins with different spectral sensitivities, enabling the independent control of different neural populations with different wavelengths of light.

  • Kinetic Advantages: If cop2's photocycle includes faster on/off kinetics for certain transitions, this could enable higher-frequency stimulation protocols than are possible with current optogenetic tools.

  • Stability Considerations: The exceptional stability of cop2 in extreme conditions suggests that it might maintain functionality in challenging in vivo environments longer than current optogenetic actuators, potentially extending the viable duration of optogenetic experiments .

To optimize cop2 for optogenetic applications, researchers would need to:

  • Engineer variants with enhanced expression in mammalian cells

  • Potentially modify the protein to function efficiently at physiological pH and salt concentrations

  • Characterize and possibly modify the ion selectivity to achieve desired physiological effects

These engineering efforts would need to be guided by detailed structural and functional characterization of the wild-type protein and systematic mutational analysis .

How can alternative carbon sources be utilized for sustainable production of Cruxrhodopsin-2?

Research has demonstrated that Haloarcula species can produce cruxrhodopsin using various waste streams as carbon sources, offering sustainable and economical alternatives to conventional media. These approaches not only reduce production costs but also contribute to environmental remediation:

Waste Streams as Carbon Sources:

  • Petrochemical Wastewater:

    • Studies with Haloarcula sp. IRU1 showed successful cruxrhodopsin production using petrochemical wastewater as a carbon source

    • Optimal production was achieved with 2% (w/v) petrochemical wastewater, 0.2% (w/v) yeast extract, and 0.004% (w/v) KH2PO4

    • This approach resulted in approximately 44.24% predicted value for cruxrhodopsin production

  • Textile Wastewater:

    • Haloarcula sp. IRU1 demonstrated capability for cruxrhodopsin production using textile wastewater

    • Optimal conditions included textile wastewater at 0.25% (v/v), yeast extract at 0.025% (w/v), and KH2PO4 at 0.005% (w/v)

    • The Taguchi experimental design was effective in optimizing these parameters for maximum yield

Methodological Considerations for Alternative Carbon Source Implementation:

  • Waste Characterization and Pretreatment:

    • Chemical oxygen demand (COD) measurement to standardize waste input (typical textile wastewater: ~700 mg/ml)

    • pH adjustment (typically to 7.0-7.5) for optimal growth and expression

    • Potential dilution to manage toxicity effects

    • Filtration to remove particulates

  • Process Monitoring Parameters:

    • Growth curves measured by optical density at 600 nm

    • Cruxrhodopsin production quantified spectrophotometrically

    • Substrate utilization tracked by COD reduction

    • Correlating expression levels with waste composition parameters

  • Process Optimization Using Taguchi Design:

    • Systematic evaluation of factor effects (carbon source, nitrogen source, phosphorus source)

    • Analysis of variance (ANOVA) to determine significance of factors

    • Prediction of optimal conditions based on factorial designs

The implementation of these waste streams offers dual benefits: it provides a low-cost substrate for valuable biomacromolecule production while simultaneously contributing to the treatment of industrial effluents. Research indicates that the halophilic nature of Haloarcula species makes them particularly suitable for handling these waste streams, as the high salt conditions inhibit many competing microorganisms and reduce contamination risks .

What challenges exist in scaling up Cruxrhodopsin-2 production, and how might they be addressed?

Scaling up Cruxrhodopsin-2 production from laboratory to industrial scale presents several challenges that require systematic approaches:

Challenge 1: Maintaining Extreme Culture Conditions
Haloarcula species require high salt concentrations (3-4M NaCl) and specific temperature conditions.

Methodological Solutions:

  • Design specialized bioreactors with corrosion-resistant materials (e.g., titanium or specialized polymers)

  • Implement precise temperature control systems (±0.5°C)

  • Develop continuous or semi-continuous processes to maintain consistent salt concentrations

  • Consider immobilized cell systems to enhance stability and facilitate media replacement

Challenge 2: Low Expression Levels
Cruxrhodopsin-2 accounts for only 0.05 nmol/mg protein in natural producers, which is 20-30 fold less than bacteriorhodopsin in Halobacterium salinarium .

Methodological Solutions:

  • Develop overexpression systems using strong, inducible promoters

  • Optimize codon usage for the expression host

  • Engineering of the leader sequence for enhanced membrane targeting

  • Implement fed-batch strategies with optimized induction timing

  • Consider genetic modification to enhance yields:

    • Knockout competing metabolic pathways

    • Upregulate relevant chaperones for proper folding

Challenge 3: Ensuring Proper Folding and Chromophore Integration
Retinal incorporation and proper protein folding are critical for functional cop2.

Methodological Solutions:

  • Optimize retinal supplementation timing and concentration

  • Monitor spectroscopic properties during production to assess functional protein levels

  • Implement in-line monitoring of absorption characteristics

  • Develop post-expression refolding protocols if necessary

Challenge 4: Purification at Scale
Membrane protein purification presents unique challenges at industrial scale.

Methodological Solutions:

  • Develop tangential flow filtration protocols for initial concentration

  • Scale up detergent-based extraction with recycling systems to reduce costs

  • Implement expanded bed adsorption for initial capture steps

  • Utilize continuous chromatography systems for higher throughput

  • Develop non-chromatographic purification alternatives such as aqueous two-phase systems

Case Study: Scale-up Strategy for Cruxrhodopsin Production Using Waste Carbon Sources

ScaleWorking VolumeKey ConsiderationsMonitoring Parameters
Laboratory1-10 LProof of concept, parameter optimizationOD600, spectroscopic analysis, SDS-PAGE
Pilot100-500 LProcess validation, preliminary economicsOnline OD, pH, DO, automated sampling
Production1000-5000 LCost optimization, continuous processingIntegrated control systems, in-line product analysis

Each scale-up stage requires complete reassessment of mixing, mass transfer, and heat transfer parameters. The extreme halophilic conditions present unique engineering challenges that must be addressed through specialized equipment and process design. Successful scale-up requires integration of bioprocess engineering principles with the unique biological requirements of Haloarcula species .

What structural features of Cruxrhodopsin-2 are critical for function, and how can they be modified for enhanced properties?

Understanding the structure-function relationship in Cruxrhodopsin-2 is crucial for rational engineering approaches aimed at enhancing or modifying its properties:

Critical Structural Elements for Function:

  • Retinal Binding Pocket:

    • Lysine residue (equivalent to K216 in bacteriorhodopsin) forms the Schiff base with retinal

    • Surrounding aromatic residues help position the chromophore properly

    • Water molecules in the binding pocket contribute to the hydrogen-bonding network essential for proton transfer

  • Proton Translocation Pathway:

    • Conserved charged residues (analogous to D85, D96, E194, and D212 in bacteriorhodopsin) create the proton pathway

    • These residues show high conservation across archaeal rhodopsins, underscoring their functional importance

    • The spatial arrangement of these residues is critical for directional proton pumping

  • Extracellular and Cytoplasmic Half-Channels:

    • These regions control access of protons to the Schiff base from either side of the membrane

    • Conformational changes in these regions during the photocycle regulate proton uptake and release

Engineering Approaches for Enhanced Properties:

  • Spectral Tuning Strategies:

    • Mutations in the retinal binding pocket can shift absorption maxima

    • Target residues within 5Å of the retinal chromophore

    • Specific approaches include:

      • Introducing polar residues to alter hydrogen bonding with the Schiff base

      • Modifying the electrostatic environment around the polyene chain

      • Altering steric constraints on the retinal conformation

  • Enhancing Photocycle Kinetics:

    • Mutations affecting the E194 equivalent can modify reprotonation rates

    • Altering residues that participate in conformational changes can speed up or slow down specific photocycle transitions

    • Engineering the proton release complex can modify the rate-limiting steps

  • Stability Engineering:

    • Introduction of disulfide bridges at strategic positions to enhance thermal stability

    • Optimization of surface charges to improve solubility without affecting function

    • Modifying lipid-protein interfaces to enhance membrane integration

Experimental Design for Protein Engineering:

  • Structure-Guided Approach:

    • Use homology modeling based on related structures (e.g., bacteriorhodopsin, archaerhodopsin, cruxrhodopsin-3)

    • Identify critical residues through sequence alignment and structural prediction

    • Design focused mutation libraries targeting specific functional domains

  • Directed Evolution Strategy:

    • Develop high-throughput screening based on spectroscopic properties

    • Implement FACS-based screening for expression level and functional protein

    • Combine rational design with random mutagenesis for optimal results

  • Characterization Pipeline:

    • Spectroscopic analysis of variants (absorption spectra, photocycle kinetics)

    • Functional assays for proton pumping efficiency

    • Stability assessments under various conditions (temperature, pH, detergents)

By systematically exploring these structure-function relationships and applying both rational design and directed evolution approaches, researchers can develop Cruxrhodopsin-2 variants with enhanced properties for specific applications in optogenetics, biosensing, and bioelectronics .

How does the membrane environment affect Cruxrhodopsin-2 function, and what are the implications for experimental design?

The membrane environment plays a critical role in modulating Cruxrhodopsin-2 function, influencing everything from folding and stability to functional parameters like photocycle kinetics and proton pumping efficiency. Understanding these membrane effects is essential for proper experimental design and interpretation of results:

Membrane Parameters Affecting cop2 Function:

  • Lipid Composition Effects:

    • Native Haloarcula membranes contain archaeal lipids (archaeols and caldarchaeols) with ether linkages rather than ester linkages found in bacterial or eukaryotic membranes

    • These archaeal lipids provide exceptional stability under extreme conditions

    • The polar headgroup composition affects surface charge distribution around the protein

  • Hydrophobic Mismatch Considerations:

    • The hydrophobic thickness of cop2 must match the surrounding membrane to prevent distortion

    • Mismatch can cause protein tilting, aggregation, or conformational changes

    • Native Haloarcula membranes provide the optimal hydrophobic environment for cop2

  • Lateral Pressure Profile:

    • Different lipid compositions create distinct lateral pressure profiles within the membrane

    • These pressure differences can affect the equilibrium between different conformational states

    • Consequently, photocycle kinetics and pumping efficiency are affected

Methodological Approaches to Address Membrane Effects:

  • Membrane Mimetic Selection for in vitro Studies:

    Membrane SystemAdvantagesLimitationsBest Applications
    Detergent micellesSimple preparation, good for purificationPoor mimetic of native bilayerInitial characterization, crystallization
    LiposomesGood bilayer mimetic, controllable compositionHeterogeneous size, challenging for some assaysFunctional studies, proton pumping assays
    NanodiscsDefined size, accessible from both sidesComplex preparation, limited sizeDetailed biophysical characterization
    Lipid cubic phasesNative-like environment, good for crystallizationComplex preparation and handlingStructural studies, crystallization
    Supported lipid bilayersCompatible with surface techniquesOne side inaccessibleSurface-sensitive spectroscopy, AFM studies
  • Reconstitution Protocols Optimization:

    • Detergent selection is critical: mild detergents like DDM preserve function better than harsh detergents

    • Lipid-to-protein ratio affects protein density and function (optimal ratios typically 100-200:1 mol/mol)

    • Removal method for detergent affects reconstitution efficiency (dialysis vs. biobeads vs. cyclodextrin)

  • Experimental Design Considerations:

    • Always include membrane composition as an explicit variable in experiments

    • Use multiple membrane systems to verify that observations are not artifacts of a particular membrane environment

    • Consider the effect of membrane composition when translating results between different experimental systems

  • Advanced Characterization of Membrane Effects:

    • Solid-state NMR to probe protein-lipid interactions

    • EPR with site-directed spin labeling to measure conformational dynamics in different membrane environments

    • Molecular dynamics simulations to predict membrane effects on structure and dynamics

Implications for Applications:

When developing cop2 for applications like optogenetics or bioelectronics, the membrane environment must be carefully considered. For example, the protein may require specific lipid compositions for optimal function when expressed in mammalian cells for optogenetic applications. Similarly, for bioelectronic devices, the supporting membrane or matrix must provide the appropriate physicochemical environment for protein function.

By systematically investigating membrane effects and incorporating this knowledge into experimental design, researchers can avoid artifacts and develop more effective applications for Cruxrhodopsin-2 .

What are common challenges in recombinant Cruxrhodopsin-2 preparation, and how can they be systematically addressed?

Working with recombinant Cruxrhodopsin-2 presents several technical challenges that researchers frequently encounter. Systematic approaches to troubleshooting these issues can significantly improve experimental outcomes:

Challenge 1: Low Expression Levels

Possible Causes:

  • Codon usage incompatibility

  • Toxicity to expression host

  • Poor translation efficiency

  • Protein misfolding and degradation

Systematic Solutions:

  • Optimize codon usage for expression host

  • Use tunable promoter systems to balance expression and toxicity

  • Lower induction temperature (20-25°C) to improve folding

  • Co-express molecular chaperones (e.g., GroEL/ES)

  • Add retinal earlier in expression phase

  • Try different E. coli strains (C41/C43, Lemo21)

Verification Methods:

  • Western blot analysis of expression levels at different time points

  • Fractionation to determine if protein is in inclusion bodies

  • RT-qPCR to assess transcript levels

Challenge 2: Poor Functional Yield (Protein Expresses but Lacks Chromophore)

Possible Causes:

  • Insufficient retinal

  • Improper protein folding

  • Retinal degradation

  • Improper pH or ionic conditions

Systematic Solutions:

  • Increase retinal concentration (up to 20 μM)

  • Add retinal at multiple time points during expression

  • Protect cultures from light during growth

  • Optimize pH and salt concentration in growth medium

  • Add retinal during purification for apoprotein reconstitution

  • Verify retinal quality and prepare fresh solutions

Verification Methods:

  • UV-Vis spectroscopy to monitor characteristic absorption

  • Calculate ratio of 280 nm to λmax absorption to assess chromophore incorporation

  • SDS-PAGE with and without sample boiling (retinal-bound protein often shows different migration)

Challenge 3: Protein Instability During Purification

Possible Causes:

  • Detergent-induced denaturation

  • Proteolytic degradation

  • Aggregation

  • Loss of retinal during purification

Systematic Solutions:

  • Screen multiple detergents at various concentrations

    DetergentConcentration RangeNotes
    DDM0.5-1% for extraction, 0.05% for purificationMild, good for function
    OG1-2% for extraction, 0.7% for purificationHarsher but better for crystallization
    DMPC/CHAPSO2:1 ratio, total 2%Good for maintaining native-like environment
  • Include protease inhibitors throughout purification

  • Maintain low temperature (4°C) throughout process

  • Add glycerol (10-20%) to stabilize protein

  • Supplement buffers with retinal to prevent chromophore loss

  • Minimize light exposure during purification

Verification Methods:

  • Size exclusion chromatography to assess aggregation state

  • Functional assays at each purification step

  • Thermal stability assays with different buffer conditions

Challenge 4: Poor Reconstitution into Liposomes or Membranes

Possible Causes:

  • Inappropriate lipid composition

  • Inefficient detergent removal

  • Protein aggregation during reconstitution

  • Incorrect protein orientation

Systematic Solutions:

  • Optimize lipid composition (try different combinations of POPC, POPE, POPG)

  • Screen detergent removal methods (dialysis, biobeads, cyclodextrin)

  • Adjust lipid-to-protein ratio (typically 100-200:1 mol/mol)

  • Control rate of detergent removal (slower often better)

  • Add functional assays to verify protein orientation

Verification Methods:

  • Dynamic light scattering to assess proteoliposome size and homogeneity

  • Freeze-fracture electron microscopy to visualize protein distribution

  • Proton pumping assays with pH-sensitive dyes

By implementing these systematic troubleshooting approaches, researchers can significantly improve the yield and quality of recombinant Cruxrhodopsin-2 preparations, enabling more reliable and reproducible experiments across various applications .

How can spectroscopic data of Cruxrhodopsin-2 be correctly analyzed to extract photocycle kinetics?

Accurate analysis of spectroscopic data is essential for characterizing the photocycle kinetics of Cruxrhodopsin-2. The following methodological approach outlines the steps for rigorous data collection and analysis:

Experimental Setup and Data Collection:

  • Sample Preparation:

    • Purified cop2 (1-2 mg/ml) in appropriate buffer

    • Path length selection based on protein concentration (typically 1 mm for concentrated samples)

    • Temperature control (20-25°C standard, but variable for temperature-dependence studies)

  • Flash Photolysis Protocol:

    • Excitation source: Nd:YAG laser (532 nm) or LED with appropriate wavelength

    • Probe: Continuous xenon arc lamp with monochromator

    • Signal detection: Photomultiplier with appropriate amplification

    • Time resolution: Nanoseconds to seconds to capture full photocycle

    • Wavelength selection: Multiple wavelengths corresponding to known or expected intermediates

  • Data Acquisition Parameters:

    • Logarithmic time base for efficient capture of multi-exponential processes

    • Signal averaging (typically 10-20 traces) to improve signal-to-noise ratio

    • Dark adaptation period between flashes (10-20 seconds) to ensure complete photocycle completion

Data Analysis Methodology:

  • Pre-processing Steps:

    • Baseline correction and normalization

    • Noise filtering (Savitzky-Golay or wavelet-based methods)

    • Correction for instrument response function

    • Conversion of transmission data to absorbance changes

  • Multi-wavelength Global Analysis:

    • Simultaneous fitting of kinetic traces from multiple wavelengths

    • Selection of kinetic model (sequential, parallel, or branched)

    • Parameter estimation using non-linear least squares algorithms

    • Model comparison using statistical criteria (χ², AIC, BIC)

  • Component Spectra Extraction:

    • Singular value decomposition (SVD) to determine number of significant components

    • Calculation of spectral properties of each photocycle intermediate

    • Comparison with known spectral properties of related rhodopsins

Mathematical Framework for Kinetic Analysis:

For a sequential photocycle model:

cop2k1I1k2I2k3cop2\text{cop2} \xrightarrow{k_1} \text{I}_1 \xrightarrow{k_2} \text{I}_2 \xrightarrow{k_3} \text{cop2}

The time-dependent concentrations follow:

d[cop2]dt=k1[cop2]+k3[I2]\frac{d[\text{cop2}]}{dt} = -k_1[\text{cop2}] + k_3[\text{I}_2] d[I1]dt=k1[cop2]k2[I1]\frac{d[\text{I}_1]}{dt} = k_1[\text{cop2}] - k_2[\text{I}_1] d[I2]dt=k2[I1]k3[I2]\frac{d[\text{I}_2]}{dt} = k_2[\text{I}_1] - k_3[\text{I}_2]

The absorbance change at wavelength λ and time t is:

ΔA(λ,t)=iΔϵi(λ)ci(t)d\Delta A(\lambda, t) = \sum_i \Delta \epsilon_i(\lambda) \cdot c_i(t) \cdot d

where Δεᵢ(λ) is the differential extinction coefficient of intermediate i, cᵢ(t) is its concentration at time t, and d is the path length.

Software Tools and Implementation:

SoftwareCapabilitiesLimitationsBest For
MATLAB with custom scriptsHighly customizable, transparentRequires programming expertiseAdvanced analysis, novel models
Origin Pro with Global FittingUser-friendly interface, good visualizationLimited model flexibilityStandard analyses, publication-quality figures
PyTorch-based frameworksGPU acceleration, modern optimizationSteep learning curveVery large datasets, complex models
TIMP/R packageSpecialized for global analysisLess intuitive interfaceRigorous statistical analysis

Validation and Quality Control:

  • Residual Analysis:

    • Systematic deviations indicate model inadequacy

    • Random residuals support model validity

    • Autocorrelation analysis to detect temporal patterns

  • Temperature Dependence Studies:

    • Arrhenius plots to extract activation energies

    • Verification that all processes follow expected temperature dependence

    • Identification of rate-limiting steps

  • pH and Salt Dependence:

    • Titration curves to identify key protonation events

    • pH-dependent spectral shifts for pKa determination

    • Salt effects to probe electrostatic interactions

By following this methodological framework, researchers can extract reliable kinetic parameters that characterize the cop2 photocycle, enabling comparison with other rhodopsins and providing insights into structure-function relationships essential for protein engineering applications .

What emerging applications of Cruxrhodopsin-2 show the most promise for interdisciplinary research?

Cruxrhodopsin-2 sits at the intersection of several rapidly advancing fields, offering unique opportunities for interdisciplinary research. The following emerging applications demonstrate particular promise:

Advanced Bioelectronic Interfaces

The integration of cop2 into synthetic membranes and electronic devices creates possibilities for novel biosensors and bioelectronic systems:

  • Neural Interface Development: cop2's proton-pumping capability can be coupled with pH-sensitive materials to create light-responsive neural interfaces that avoid the limitations of electrical stimulation

  • Biomolecular Computing Elements: The photocycle states can serve as the basis for biomolecular logic gates and memory elements with nanoscale dimensions

  • Self-Powered Biosensors: cop2's ability to generate proton gradients in response to light could be coupled with ATP synthase to create self-powered sensing systems

Methodological Approaches:

  • Layer-by-layer assembly of cop2-containing membranes on electrode surfaces

  • Integration with 2D materials (graphene, MoS₂) for enhanced signal transduction

  • Development of spectroelectrochemical techniques for simultaneous optical and electrical characterization

Next-Generation Optogenetic Tools

While channelrhodopsins currently dominate optogenetics, cop2's unique properties offer potential advantages for specific applications:

  • Spectrally-Shifted Actuators: Engineering cop2 variants with red-shifted absorption for deeper tissue penetration

  • Biophotonic Signal Amplification: Using cop2's proton-pumping capability to modulate local pH, which can then trigger secondary responses through pH-sensitive ion channels

  • Long-Term In Vivo Stability: The exceptional stability of archaeal rhodopsins could be leveraged for longer-lasting optogenetic interventions

Methodological Approaches:

  • Structure-guided mutagenesis to optimize spectral properties

  • Development of mammalian expression systems with enhanced membrane targeting

  • In vivo characterization using combined electrophysiology and imaging

Sustainable Bioproduction Systems

The ability of Haloarcula species to produce cop2 while utilizing waste streams creates opportunities for integrated bioremediation and bioproduction:

  • Closed-Loop Bioproduction: Systems that couple wastewater treatment with valuable protein production

  • Photobioreactors: Light-driven systems that leverage the photosynthetic capabilities of engineered organisms expressing cop2

  • Extremophile-Based Bioprocessing: Development of bioproduction systems that operate under extreme conditions (high salt, high temperature) to reduce contamination risks

Methodological Approaches:

  • Metabolic engineering of Haloarcula species for enhanced productivity

  • Development of specialized photobioreactors with optimized light delivery

  • Integration with downstream processing for continuous production

Biomimetic Photosensory Systems

The natural photodetection capabilities of microbial rhodopsins can inspire artificial systems:

  • Artificial Retinas: cop2-based photodetectors arranged in arrays mimicking retinal organization

  • Dynamic Light-Responsive Materials: Smart materials incorporating cop2 for applications in adaptive optics or light-responsive surfaces

  • Biomimetic Image Processing: Networks of cop2-based photodetectors with built-in signal processing capabilities inspired by biological vision systems

Methodological Approaches:

  • 3D bioprinting of precisely arranged cop2-containing membranes

  • Development of hydrogel or polymer matrices compatible with functional cop2

  • Integration with microfluidics for dynamic control of the protein environment

These emerging applications represent fertile ground for interdisciplinary collaboration among molecular biologists, materials scientists, bioengineers, and computational scientists. The unique properties of cop2—particularly its stability under extreme conditions, light-driven proton pumping, and potential for genetic engineering—make it an attractive component for these next-generation technologies.

How might computational approaches enhance our understanding and engineering of Cruxrhodopsin-2?

Computational methods offer powerful tools for understanding and engineering Cruxrhodopsin-2, enabling predictions and insights that can guide experimental work and accelerate discovery. The following approaches represent particularly promising directions:

Advanced Structural Modeling and Dynamics

Despite the lack of a high-resolution crystal structure specifically for cop2, computational approaches can provide valuable structural insights:

  • Homology Modeling with Enhanced Accuracy:

    • Integration of experimental constraints from spectroscopic data

    • Refinement using mixed quantum mechanics/molecular mechanics (QM/MM) methods

    • Validation through multiple template comparison and energy minimization

  • Molecular Dynamics Simulations:

    • Long-timescale simulations (microseconds to milliseconds) to capture conformational changes

    • Enhanced sampling techniques (metadynamics, replica exchange) to explore energy landscapes

    • Inclusion of membrane environment effects using complex lipid compositions

    • Coarse-grained simulations for larger-scale phenomena and longer timescales

Implementation Strategy:

  • Build initial homology models based on related structures (cruxrhodopsin-3, bacteriorhodopsin)

  • Refine models using experimental constraints from spectroscopic data

  • Validate through energy analysis and comparison with experimental observables

  • Perform targeted simulations of photocycle-related conformational changes

Quantum Mechanical Approaches for Spectral Tuning

The spectral properties of cop2 are critical for its function and applications. Quantum mechanical methods can provide insights for rational engineering:

  • Excited State Calculations:

    • Time-dependent density functional theory (TD-DFT) to predict absorption spectra

    • QM/MM methods to include protein environment effects on chromophore

    • Calculation of transition dipole moments for spectroscopic properties

  • Structure-Spectrum Relationships:

    • Systematic modeling of mutations and their effects on spectral properties

    • Development of predictive models for spectral tuning

    • Implementation of machine learning approaches trained on calculated and experimental data

Implementation Strategy:

  • Calculate ground and excited state properties of retinal in various protein environments

  • Develop datasets linking structural features to spectral properties

  • Train machine learning models to predict spectral shifts from sequence/structure

  • Apply models to design variants with desired spectral properties

Network Analysis and Allosteric Communication

Understanding how energy and information flow through the protein structure can reveal targets for engineering:

  • Residue Interaction Networks:

    • Graph-based representations of protein structure

    • Identification of critical nodes and pathways using centrality measures

    • Detection of allosteric communication pathways

  • Community Analysis:

    • Identification of dynamically coupled regions

    • Leveraging community structures for targeted mutations

    • Prediction of allosteric effects of mutations

Implementation Strategy:

  • Construct residue interaction networks from MD trajectories

  • Identify critical nodes using various centrality measures

  • Map key pathways for proton transfer and conformational change

  • Design mutations that modulate allosteric communication for desired effects

Machine Learning for Protein Engineering

The growing body of data on rhodopsins provides opportunities for machine learning approaches to guide engineering:

  • Sequence-Function Relationships:

    • Deep learning models trained on rhodopsin sequences and functional data

    • Identification of non-obvious sequence determinants of function

    • Prediction of function-enhancing mutations

  • Generative Models for Protein Design:

    • Variational autoencoders or generative adversarial networks for novel sequence design

    • Reinforcement learning approaches to optimize multiple properties simultaneously

    • Integration of structural constraints into sequence generation

Implementation Strategy:

  • Compile comprehensive datasets of rhodopsin sequences, structures, and functional properties

  • Train and validate predictive models for properties of interest

  • Develop generative models capable of designing novel sequences

  • Implement experimental validation pipelines for computational predictions

Systems Biology Modeling for Expression Optimization

Understanding the cellular context of cop2 expression can guide optimization strategies:

  • Metabolic Modeling:

    • Genome-scale metabolic models of expression hosts

    • Identification of limiting factors in protein and cofactor synthesis

    • Prediction of optimal media composition and feeding strategies

  • Gene Expression Models:

    • Models of transcription, translation, and protein folding

    • Optimization of codon usage and regulatory elements

    • Prediction of expression-enhancing modifications

Implementation Strategy:

  • Develop or adapt metabolic models for relevant expression hosts

  • Integrate models of protein synthesis and folding

  • Perform in silico optimization of expression conditions

  • Validate predictions through targeted experiments

These computational approaches provide a powerful complement to experimental methods, offering insights that may be difficult or impossible to obtain through experiments alone. The integration of these computational strategies with experimental validation creates a powerful framework for understanding and engineering Cruxrhodopsin-2 for various applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.