Recombinant Haloarcula vallismortis Cruxhalorhodopsin-3 (choP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
choP3; Cruxhalorhodopsin-3; CHR-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-276
Protein Length
Full Length of Mature Protein
Species
Haloarcula vallismortis (Halobacterium vallismortis)
Target Names
choP3
Target Protein Sequence
EIQSNFLLNSSLWVNIALAGVVILLFVAMGRELESSRAKLIWVATMLVPLVSISSYAGLA SGLTVGFLQMPPGHALAGQEVLSPWGRYLTWTFSTPMILLALGLLADTDMASLFTAITMD IGMCITGLAAALVTSSHLLRWVFYGISCAFFIAVLYVLLVEWPADAEAAGTSEIFGTLKL LTVVLWLGYPILWALGSEGVALLSVGVTSWGYSGLDILAKYVFAFLLLRWVAANEDTVTQ AGMSLGSGGAAPADD
Uniprot No.

Target Background

Function
Light-driven chloride pump.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cruxrhodopsin-3 (cR3) and what is its biological function?

Cruxrhodopsin-3 (cR3) is a retinylidene protein found in the claret membrane of Haloarcula vallismortis that functions as a light-driven proton pump. This membrane protein plays a crucial role in the organism's bioenergetics by converting light energy into an electrochemical proton gradient across the cell membrane, which can subsequently be utilized for ATP synthesis and other cellular processes .

The protein contains a retinal chromophore that undergoes photoisomerization upon light absorption, initiating a series of conformational changes that enable proton translocation across the membrane. This light-harvesting capability allows H. vallismortis to thrive in high-salt environments where it can leverage solar energy as a supplementary energy source .

How does cR3 differ structurally from other archaeal rhodopsins?

While cR3 shares the basic seven-transmembrane helix architecture common to archaeal rhodopsins, crystallographic studies at 2.1 Å resolution have revealed several distinctive structural features:

  • Extended DE loop - cR3 possesses a longer DE loop that interacts with neighboring protein subunits, strengthening its trimeric assembly structure .

  • Cytoplasmic charge distribution - Three positive charges are distributed at the cytoplasmic end of helix F, which affects the higher-order structure of cR3 .

  • Retinal pocket rigidity - The cytoplasmic vicinity of retinal is more rigid in cR3 than in bacteriorhodopsin, affecting the early reaction steps in the proton-pumping cycle .

  • Helix E conformation - The cytoplasmic part of helix E is significantly bent, which influences the proton uptake process .

These structural peculiarities contribute to cR3's specific photochemical properties and its stability within the membrane environment.

What experimental evidence suggests cR3 forms a trimeric assembly in vivo?

Crystallographic data at 2.1 Å resolution definitively shows that cR3 forms a trimeric assembly belonging to space group P321. This trimeric structure includes bacterioruberin bound to the crevice between neighboring subunits, suggesting a stabilizing role for this carotenoid in maintaining the quaternary structure .

Functional studies provide additional evidence for the importance of this trimeric assembly. When the trimeric structure is disrupted by excess detergent, causing dissociation into monomers, photobleaching of retinal increases significantly. This observation indicates that the trimeric assembly confers protection against photodegradation under physiological conditions .

The extended DE loop in cR3, which interacts with neighboring subunits, further supports the biological relevance of the trimeric state, as this structural feature appears specifically adapted to reinforce oligomerization .

What considerations are important when designing experiments to express and purify recombinant cR3?

When designing experiments for recombinant cR3 expression and purification, researchers should consider the following key factors:

  • Expression system selection - Heterologous expression in E. coli or Halobacterium systems requires optimization based on the research goals. For structural studies, expression systems that facilitate post-translational modifications similar to the native archaea may be preferable.

  • Detergent selection - Critical for maintaining the trimeric structure of cR3 during purification. Experimental evidence indicates that excess detergent can dissociate the trimeric assembly into monomers, significantly affecting protein function and stability .

  • Retinal supplementation - All-trans-retinal must be available during expression to form functional protein with the chromophore properly incorporated.

  • Purification strategy - When designing affinity purification approaches, tag placement should avoid interference with the DE loop interactions that stabilize the trimeric assembly .

  • Quality control - Spectroscopic analysis should be performed throughout purification to ensure the protein maintains its characteristic absorption properties, indicating proper folding and chromophore incorporation.

A systematic approach that carefully controls these variables is essential for obtaining functional recombinant cR3 suitable for downstream applications.

How should researchers design experiments to study the photocycle of cR3?

Designing experiments to study the cR3 photocycle requires careful consideration of several parameters:

Experimental ParameterConsiderationsImportance
Spectroscopic techniqueTime-resolved absorption spectroscopy with microsecond to millisecond resolutionEnables identification of photointermediates
pH conditionsRange of pH values from 4.0 to 9.0Critical as cR3 exhibits pH-dependent absorption maxima (D540 at low pH, D500 at high pH)
Temperature controlConstant temperature maintained throughout measurementsPhotocycle kinetics are temperature-dependent
Light sourceFlash photolysis with appropriate wavelength matching absorption maximumEnsures complete photoactivation
Sample preparationDetergent concentration carefully controlledPrevents unwanted monomerization of trimeric assembly

Flash photolysis experiments should be designed to capture the sequential population of photoproducts during the photocycle. For cR3, after light excitation, the D540 dark state bleaches and at least two photoproducts (P600 and P500) are sequentially populated during the photocycle .

Control experiments should include measurements under varying ionic conditions and with specific inhibitors to elucidate the mechanism of proton translocation.

What are the key variables to control in experimental designs comparing cR3 with other rhodopsins?

When designing comparative experiments between cR3 and other rhodopsins (such as bacteriorhodopsin or channelrhodopsins from other organisms), researchers should control the following variables:

  • Protein concentration - Must be normalized across all samples to enable direct comparison of activity and spectral properties.

  • Membrane/detergent environment - The lipid or detergent environment significantly affects rhodopsin function; identical conditions must be maintained for valid comparisons.

  • Light intensity and wavelength - Should be optimized for each rhodopsin's absorption maximum, with equivalent photon flux when comparing activities.

  • Temperature and pH - These factors affect both absorption properties and photocycle kinetics, as evidenced by cR3's pH-dependent absorption shifts between D540 and D500 forms .

  • Measuring conditions - Time-resolved measurements should use consistent time ranges and sampling intervals to facilitate direct comparison of photocycle kinetics.

Such controlled comparative studies are essential for understanding how the unique structural features of cR3, such as its bent helix E and extended DE loop, contribute to its functional differences from other archaeal rhodopsins .

How can researchers address contradictions in spectroscopic data from cR3 studies?

When analyzing spectroscopic data from cR3 studies, researchers may encounter apparent contradictions that require systematic resolution. Using the contradiction pattern framework described in bioinformatics literature, these can be approached using three parameters (α, β, θ): the number of interdependent items (α), the number of contradictory dependencies defined by domain experts (β), and the minimal number of required Boolean rules to assess these contradictions (θ) .

Common sources of contradictions in cR3 spectroscopic data include:

  • pH-dependent spectral shifts - cR3 exhibits different absorption maxima at different pH values (D540 at low pH, shifting to D500 at high pH), which could appear contradictory if pH is not precisely controlled or reported .

  • Sample heterogeneity - Mixtures of monomeric and trimeric forms resulting from varying detergent concentrations can produce seemingly contradictory spectral features .

  • Photocycle intermediate overlap - The sequential photoproducts P600 and P500 may have overlapping lifetimes, complicating kinetic analysis .

To resolve these contradictions, researchers should:

  • Implement strict quality control measures to ensure sample homogeneity

  • Conduct measurements across pH gradients to map pH-dependent properties

  • Apply global fitting analysis to spectroscopic data

  • Consider the minimum number of Boolean rules needed to explain the observed contradictions, as this approach can significantly reduce complexity in data interpretation .

What statistical approaches are most appropriate for analyzing proton-pumping efficiency data?

Analyzing proton-pumping efficiency data for cR3 requires robust statistical approaches that account for the complexities of biophysical measurements. Recommended statistical approaches include:

  • Experimental design considerations:

    • Minimum of three biological replicates and three technical replicates

    • Inclusion of appropriate controls (dark controls, ionophore controls)

    • Standardization of measurement conditions (pH, temperature, ionic strength)

  • Statistical methods:

    • ANOVA for comparing conditions with Tukey's post-hoc test for multiple comparisons

    • Non-parametric alternatives (Kruskal-Wallis test) when data do not meet normality assumptions

    • Time-series analysis for kinetic data with appropriate curve fitting models

  • Data normalization approaches:

    • Normalization to protein concentration

    • Internal standards to account for instrument drift

    • Baseline correction methods

When implementing these approaches, researchers should carefully document all data processing steps to ensure reproducibility, following the principles outlined in experimental design literature .

How can researchers integrate structural data with functional measurements to enhance understanding of cR3?

Integrating structural and functional data provides a comprehensive understanding of cR3's mechanistic properties. Effective integration strategies include:

  • Structure-function correlation mapping - Correlate specific structural features identified in crystallographic studies (e.g., the bent cytoplasmic part of helix E) with functional parameters such as proton uptake kinetics .

  • Mutagenesis studies - Systematically modify key residues identified in the crystal structure and measure the impact on function. For example, mutations affecting the DE loop could alter trimeric stability and subsequently impact photostability .

  • Molecular dynamics simulations - Use the 2.1 Å crystal structure as input for simulations to explore dynamic aspects not captured by static structural methods, particularly conformational changes during the photocycle.

  • Spectroscopic integration - Correlate spectroscopic signatures with structural transitions, especially focusing on the sequential population of photoproducts P600 and P500 during the photocycle .

This integrative approach helps resolve contradictions that might appear when analyzing data from a single methodology in isolation, providing a more robust foundation for understanding cR3's structure-function relationships.

How does the trimeric assembly of cR3 influence its photostability compared to monomeric rhodopsins?

The trimeric assembly of cR3 plays a crucial role in its photostability through several mechanisms:

  • Photobleaching protection - Experimental evidence shows that photobleaching of retinal, which rarely occurs when cR3 is in its native trimeric membrane state, becomes significant when the trimeric assembly is dissociated into monomers by excess detergent .

  • Structural stabilization - The extended DE loop in cR3 interacts with neighboring subunits, strengthening the trimeric assembly and potentially limiting destabilizing conformational changes during the photocycle .

  • Bacterioruberin contribution - The carotenoid bacterioruberin, found in the crevice between neighboring subunits, may provide additional stabilization and photoprotection by quenching reactive oxygen species or dissipating excess energy .

  • Altered electrostatic environment - The three positive charges at the cytoplasmic end of helix F affect the higher-order structure and may contribute to stabilizing interactions within the trimer .

These mechanisms suggest that the evolution of the trimeric assembly in archaeal rhodopsins represents an adaptation for enhanced photostability in high-light environments, providing insights for the engineering of more stable rhodopsin variants for research applications.

What are the methodological approaches for studying pH-dependent spectral shifts in cR3?

The pH-dependent spectral shifts in cR3 (absorption maximum at 540 nm at low pH [D540] shifting to 500 nm at high pH [D500]) require specific methodological approaches for comprehensive characterization :

  • Spectroscopic titration - Systematic measurement of absorption spectra across a pH range (typically pH 4-9) with small increments to accurately determine the pKa of the transition between D540 and D500 forms.

  • Time-resolved spectroscopy at varying pH - Flash photolysis experiments conducted at different pH values to characterize how pH affects the kinetics of photoproduct formation (P600 and P500) and decay .

  • FTIR spectroscopy - Measurement of pH-dependent infrared spectral changes to identify specific protonation changes associated with the D540 to D500 transition.

  • Mutagenesis approaches - Systematic modification of residues potentially involved in the pH-sensitive transition, followed by spectroscopic characterization to identify key amino acids.

Data from these approaches should be analyzed using global fitting methods that can simultaneously account for contributions from multiple spectral species. This comprehensive methodology allows researchers to connect structural elements to specific spectroscopic properties.

What experimental design considerations are important when engineering cR3 variants for optogenetic applications?

Engineering cR3 variants for optogenetic applications requires careful experimental design considerations:

  • Spectral tuning strategy - Based on comparative analysis with channelrhodopsins from other organisms like Volvox carteri, which exhibit distinct spectral properties (VChR1 absorbs at 540 nm at low pH, while VChR2 absorbs at 460 nm) . This informs mutation targets in the retinal binding pocket.

  • Expression optimization - Design experiments to test different signal sequences and trafficking motifs that enhance membrane localization in target cells (neurons, muscle cells, etc.).

  • Functional screening approach - Develop high-throughput electrophysiological or fluorescence-based assays to efficiently screen variant libraries for desired properties.

  • Validation pipeline - Include rigorous controls and standardized protocols to validate variant performance across different experimental systems.

Engineering GoalExperimental ApproachKey MeasurementsControl Experiments
Red-shifted absorptionTarget retinal binding pocket residuesAbsorption spectroscopyComparison with wild-type cR3
Faster photocycleModify key residues in proton transport pathwayTime-resolved spectroscopyComparison with wild-type kinetics
Enhanced expressionTest trafficking sequencesFluorescence microscopy, Western blottingComparison with standard optogenetic tools
Improved photostabilityStrengthen trimeric assemblyLong-term illumination testsComparison with monomeric variants

This systematic approach enables the rational design of cR3 variants with optimized properties for specific optogenetic applications.

How do the structural and functional properties of cR3 compare with channelrhodopsins from other organisms?

Comparative analysis between cR3 from Haloarcula vallismortis and channelrhodopsins from other organisms reveals important differences in structure, function, and regulation:

PropertyCruxrhodopsin-3 (cR3)Volvox Channelrhodopsin-1 (VChR1)Volvox Channelrhodopsin-2 (VChR2)
FunctionLight-driven proton pumpLight-gated ion channelLight-gated ion channel
Absorption maximum540 nm (low pH), 500 nm (high pH) 540 nm (low pH), 500 nm (high pH) 460 nm
Quaternary structureTrimeric assembly Primarily monomericPrimarily monomeric
Expression regulationNot well characterizedPromoted by extended dark periods, reduced by heat stress Highly induced by sex-inducer protein
Photocycle intermediatesP600, P500 sequentially populated Complex photocycle with multiple intermediatesSimilar to ChR2 from Chlamydomonas reinhardtii
Biological roleEnergy productionPhototaxis photoreceptorGeneral photoreceptor, blue light avoidance

The expression patterns also differ significantly, with VChRs showing specific regulation by environmental factors and developmental stages, whereas cR3 expression patterns in Haloarcula vallismortis are not as well characterized .

What methodological approaches are recommended for comparative studies of proton-pumping efficiency?

When conducting comparative studies of proton-pumping efficiency between cR3 and other rhodopsins, the following methodological approaches are recommended:

  • Standardized reconstitution protocol - Identical protein-to-lipid ratios in liposome reconstitution to enable direct comparison of pumping rates.

  • Calibrated pH measurements - Use of calibrated pH indicators with appropriate pKa values for the expected pH range, with internal standards for each measurement.

  • Controlled illumination conditions:

    • Equivalent photon flux adjusted for each rhodopsin's extinction coefficient

    • Monochromatic light matched to absorption maxima of each protein

    • Defined light/dark cycles to assess recovery kinetics

  • Parallel measurement designs - Side-by-side comparison under identical buffer conditions, temperature, and measuring equipment to minimize systematic errors.

  • Multi-parameter assessment - Beyond simple pumping rates, measure:

    • Action spectra to confirm functional absorption properties

    • pH dependence of pumping activity

    • Temperature dependence to determine activation energies

    • Ion selectivity and potential secondary ion transport

This comprehensive approach allows for meaningful comparison of the functional efficiency of different rhodopsins while controlling for the variables identified in experimental design literature .

How can researchers address data quality contradictions when comparing results from different rhodopsin studies?

When comparing results from different rhodopsin studies, researchers may encounter data quality contradictions that require systematic resolution approaches:

  • Standardized contradiction assessment - Apply the (α, β, θ) framework for contradiction patterns, where α represents the number of interdependent items (e.g., different rhodopsin measurements), β represents the number of contradictory dependencies identified, and θ represents the minimal number of Boolean rules needed to assess these contradictions .

  • Metadata analysis - Evaluate experimental conditions across studies for potential sources of contradiction:

    • Detergent types and concentrations

    • Measurement temperatures

    • pH and buffer composition

    • Protein purification methods

    • Light sources and intensities

  • Replication studies - Design experiments that systematically reproduce key findings from contradictory studies under identical conditions to identify sources of variability.

  • Boolean minimization approaches - Apply methods to determine the minimum number of rules required to explain observed contradictions, potentially revealing underlying patterns not immediately apparent .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.