Recombinant Haloarcula vallismortis Cruxrhodopsin-3 (cop3)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

The cop3 gene (UniProt ID: P94854) is expressed in Escherichia coli or Halobacterium salinarum MPK409 (a bacteriorhodopsin-deficient strain) . Key production parameters:

ParameterSpecification
Expression HostE. coli or H. salinarum MPK409 .
TagN-terminal His-tag for purification .
Protein LengthFull-length (1–250 amino acids) .
Amino Acid SequenceMPAPEGEAIWLWLGTAGMFLGMLYFIARGWGETDSRRQKFYIATILITAIAFVNYLAMALGFGLTIVEIAGEQRPIYWARYSDWLFTTPLLLYDL... .
Purity>90% (SDS-PAGE) .
StorageTris/PBS buffer with 6% trehalose (pH 8.0); lyophilized at -80°C .

Functional and Spectroscopic Properties

  • Proton-Pumping Mechanism: Utilizes retinal isomerization (all-trans to 13-cis) to drive proton translocation across membranes .

  • Absorption Spectrum:

    • Membrane State: Peaks at 475 nm (bacterioruberin), 505 nm, and 541 nm .

    • Light Adaptation: Difference spectrum shows positive peak at 585 nm and negative peak at 500 nm .

  • Photoreaction Kinetics:

    • K State Decay: 30 µs at 24°C (10× slower than bacteriorhodopsin) .

    • Photostability: Enhanced in trimeric state; monomeric forms degrade rapidly under detergent .

Research Applications

  • Neuroscience: Acts as a neuron silencer in optogenetics due to its proton-pumping activity .

  • Structural Biology: Serves as a model for studying trimeric membrane protein assembly and carotenoid-protein interactions .

  • Biotechnology: Engineered variants explored for improved spectral tuning and photostability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on your location and purchasing method. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please communicate it to us, and we will prioritize its development.
Synonyms
cop3; Cruxrhodopsin-3; COP-3; CR-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Haloarcula vallismortis (Halobacterium vallismortis)
Target Names
cop3
Target Protein Sequence
MPAPEGEAIWLWLGTAGMFLGMLYFIARGWGETDSRRQKFYIATILITAIAFVNYLAMAL GFGLTIVEIAGEQRPIYWARYSDWLFTTPLLLYDLGLLAGADRNTISSLVSLDVLMIGTG LVATLSAGSGVLSAGAERLVWWGISTAFLLVLLYFLFSSLSGRVADLPSDTRSTFKTLRN LVTVVWLVYPVWWLVGTEGIGLVGIGIETAGFMVIDLVAKVGFGIILLRSHGVLDGAAET TGAGATATAD
Uniprot No.

Target Background

Function
Light-driven proton pump.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Cruxrhodopsin-3 and how was it discovered?

Cruxrhodopsin-3 (cR3) is a retinylidene protein found in the claret membrane of Haloarcula vallismortis that functions as a light-driven proton pump. It belongs to the archaeal rhodopsin family, which includes similar proteins isolated from other Haloarcula species. The discovery of cruxrhodopsins was first reported by Mukohata and colleagues, with homologous proteins found in Haloarcula argentinensis and Haloarcula mukohataei. Cruxrhodopsin-3 specifically was isolated from Haloarcula vallismortis and shows high sequence identity (>90%) with other members of the cR family, while being distinct from other archaeal proton-pumping rhodopsins like bacteriorhodopsin (48-54% sequence identity) .

For research purposes, the protein can be expressed recombinantly as a full-length 250 amino acid protein with various tags, such as an N-terminal His tag, in expression systems like E. coli for detailed structural and functional studies .

How does cR3 differ from other archaeal rhodopsins at the sequence level?

While cR3 shares the fundamental seven-transmembrane helical structure common to archaeal rhodopsins, its amino acid sequence reveals several distinctive features. The sequence identity between cR3 and bacteriorhodopsin (bR) ranges between 48-54%, indicating significant divergence despite functional similarity . This divergence is reflected in the amino acid composition of key structural elements such as the DE loop and helix F, which contain unique residues that contribute to cR3's distinctive structural and functional properties.

The full amino acid sequence of cR3 (250 residues) is: MPAPEGEAIWLWLGTAGMFLGMLYFIARGWGETDSRRQKFYIATILITAIAFVNYLAMAL GFGLTIVEIAGEQRPIYWARYSDWLFTTPLLLYDLGLLAGADRNTISSLVSLDVLMIGTG LVATLSAGSGVLSAGAERLVWWGISTAFLLVLLYFLFSSLSGRVADLPSDTRSTFKTLRN LVTVVWLVYPVWWLVGTEGIGLVGIGIETAGFMVIDLVAKVGFGIILLRSHGVLDGAAET TGAGATATAD . Research comparing this sequence with other archaeal rhodopsins reveals conserved domains critical for proton pumping alongside unique regions that may account for cR3's specific photochemical properties.

What is the functional significance of cR3's proton-pumping activity?

In its native environment, cR3 functions as a highly efficient light-driven proton pump, contributing to the bioenergetic processes of Haloarcula vallismortis. The proton-pumping mechanism involves a photocycle initiated by light absorption, which triggers a series of conformational changes that facilitate proton translocation across the membrane, generating a proton gradient that can be utilized for ATP synthesis.

Beyond its native function, cR3 has gained significant attention in the research community for its potential applications as a neuron silencer. Its powerful proton-pumping capability makes it a valuable tool for optogenetic studies, where precise control of membrane potential in targeted neurons is required. The structural information obtained from cR3 provides valuable insights for engineering novel neuron silencers with more suitable structural and spectral properties .

What expression systems are most effective for producing recombinant cR3?

Two primary expression systems have proven effective for producing recombinant cR3, each with distinct advantages depending on research objectives:

  • Halobacterium salinarum Expression: For studies requiring native-like protein with proper folding and functional characteristics, expression in a bR-deficient strain of Halobacterium salinarum (MPK409) has proven successful. This method involves cloning the cop3 gene into an appropriate vector (such as pKI72) and transforming it into the MPK409 strain. The advantage of this system is that it provides the halophilic environment and necessary cofactors for proper folding and assembly of cR3 into trimeric structures, resulting in protein with native-like spectral and functional properties .

  • E. coli Expression: For structural studies or applications requiring higher yields or specific tags, E. coli expression systems can be utilized. This approach typically involves fusion proteins with tags (such as an N-terminal His tag) to facilitate purification. While this system may require refolding or reconstitution steps to achieve fully functional protein, it offers advantages in terms of yield and the ability to incorporate modifications .

The choice between these systems depends on the specific research questions being addressed and whether native trimeric assembly and spectroscopic properties are critical to the study.

What purification strategy yields the highest quality cR3 for crystallography studies?

For high-resolution crystallography studies of cR3, a multi-step purification strategy is recommended:

  • Membrane Isolation: When expressed in Halobacterium salinarum, claret membrane vesicles containing cR3 can be isolated by repeatedly washing the transformed cells with distilled water. This process yields membrane vesicles with cR3 as the major protein component .

  • Detergent Solubilization: Careful selection of detergent type and concentration is critical, as the trimeric assembly of cR3 can be dissociated into monomers in the presence of excess detergent, affecting both structural integrity and photostability. A balance must be maintained to solubilize the protein while preserving its native oligomeric state.

  • Affinity Chromatography: For His-tagged recombinant cR3, immobilized metal affinity chromatography (IMAC) provides an efficient initial purification step.

  • Size Exclusion Chromatography: A final polishing step using size exclusion chromatography helps separate trimeric assemblies from monomeric species and other contaminants.

  • Crystallization via Membrane Fusion: The membrane fusion method has been successfully applied to crystallize cR3 into a crystal belonging to space group P321, yielding high-resolution diffraction data (2.1 Å). This method is particularly effective for preserving the native trimeric assembly and associated lipids/carotenoids .

For functional studies rather than crystallography, simpler purification protocols may be sufficient, particularly if spectroscopic purity rather than structural homogeneity is the primary concern.

How can researchers verify the structural integrity and functionality of purified cR3?

Multiple complementary approaches can be used to verify both the structural integrity and functionality of purified cR3:

  • Absorption Spectroscopy: Native cR3 exhibits characteristic absorption peaks that can be monitored to assess protein integrity. Changes in these spectral properties can indicate denaturation or loss of the chromophore. The absorption spectrum of purified claret membrane containing cR3 should be examined for characteristic peaks .

  • SDS-PAGE: Gel electrophoresis can verify protein purity (>90% is typically desired) and approximate molecular weight. For recombinant His-tagged cR3, the expected molecular weight would correspond to the 250 amino acid sequence plus the tag .

  • Flash Photolysis: Analyzing the photoreaction kinetics through flash-induced absorption changes measured at various wavelengths can confirm the functional integrity of cR3. Properly folded cR3 should exhibit characteristic photocycle kinetics that can be fitted with exponential components, distinguishable from those of bacteriorhodopsin .

  • Proton Pumping Assays: For definitive functional verification, reconstituting purified cR3 into liposomes and measuring light-induced pH changes can directly assess its proton-pumping capability.

  • Circular Dichroism: To verify secondary structure elements and proper protein folding, particularly important after expression in non-native systems like E. coli.

These complementary approaches provide a comprehensive assessment of both structural and functional integrity, essential for validating the quality of purified cR3 before proceeding with more detailed experimental analyses.

What unique structural features distinguish cR3 from other archaeal rhodopsins?

Crystallographic analysis of cR3 at 2.1 Å resolution has revealed several distinctive structural features that differentiate it from other archaeal rhodopsins:

  • Extended DE Loop: The DE loop in cR3 is significantly longer than in bacteriorhodopsin and extends to interact with neighboring subunits, contributing to the stability of the trimeric assembly. This interaction strengthens the oligomeric structure and may influence the protein's functional properties in the membrane environment .

  • Triple Positive Charge Distribution: cR3 contains three positive charges distributed along the cytoplasmic end of helix F. This unusual charge distribution affects the higher-order structure of the protein and likely influences its interaction with membrane lipids and other cellular components .

  • Rigid Retinal Vicinity: The cytoplasmic vicinity of the retinal chromophore in cR3 is more rigid compared to bacteriorhodopsin. This structural rigidity affects the early reaction steps in the proton-pumping cycle, contributing to the observed differences in photocycle kinetics between cR3 and bR .

  • Bent Cytoplasmic Helix E: The cytoplasmic part of helix E in cR3 is greatly bent, creating a large cavity between helices E and F. This structural feature influences the proton uptake process during the photocycle and may account for some of the functional differences observed between cR3 and other proton pumps .

These distinct structural elements collectively contribute to cR3's unique photochemical properties and stability characteristics, making it an interesting target for comparative studies among archaeal rhodopsins.

How does the trimeric assembly of cR3 influence its stability and photochemistry?

The trimeric assembly of cR3 plays a critical role in both its structural stability and photochemical properties:

These observations collectively suggest that the trimeric assembly of cR3 is not merely a structural feature but has profound functional implications for its photochemistry and stability in different environments.

What is the significance of bacterioruberin in the cR3 structure?

Bacterioruberin, a carotenoid molecule, plays several potentially important roles in the structure and function of cR3:

  • Structural Stabilization: Crystallographic data show that bacterioruberin binds to the crevice between neighboring subunits in the trimeric assembly of cR3. This binding likely contributes to the stability of the trimeric structure, although the residues surrounding bacterioruberin are not necessarily conserved among different archaeal rhodopsins that bind this molecule .

  • Photoprotection: Carotenoids are known for their ability to quench reactive oxygen species and absorb excess light energy. The presence of bacterioruberin in the cR3 structure may provide photoprotection, reducing the risk of oxidative damage to the protein and retinal chromophore during prolonged light exposure.

  • Potential Energy Transfer Function: By analogy with xanthorhodopsin (a light-driven proton pump found in halophilic eubacteria that utilizes salinixanthin as an antenna molecule), it has been proposed that bacterioruberin might serve a similar energetic role in cR3. The carotenoid could potentially function as a light-harvesting antenna, capturing photons and transferring energy to the retinal chromophore for more efficient light utilization .

  • Species-Specific Variation: The research suggests that the cell membrane of Haloarcula vallismortis might contain a different type of carotenoid than bacterioruberin, which could bind more strongly to the trimeric assembly of cR3. This raises interesting questions about species-specific adaptations and the co-evolution of membrane proteins and their associated lipids and carotenoids .

The exact functional significance of bacterioruberin in native cR3 remains an active area of investigation, with implications for understanding both the natural function of the protein and its potential applications in engineered systems.

How do the photoreaction kinetics of cR3 differ from bacteriorhodopsin?

Comparative analysis of the photoreaction kinetics of cR3 and bacteriorhodopsin (bR) reveals several significant differences:

  • K-State Decay Rate: The decay rate of the K state in cR3 is approximately ten times slower than in bR. This substantial difference in early photocycle kinetics likely stems from the more rigid cytoplasmic vicinity of retinal in cR3 compared to bR, affecting the initial structural changes following photoisomerization .

  • Photocycle Component Analysis: Flash-induced absorption changes measured at various wavelengths can be fitted with four exponential components in both proteins, but the amplitude distribution across wavelengths differs significantly. Figure 3 in the research shows a comparison of these amplitude spectra between cR3 and bR, highlighting their distinct photochemical behaviors .

  • M-State Decay: In the P321 crystal form of cR3, the M state decays very slowly (τ~100 ms at 24°C). This extended lifetime has been attributed to inhibition of the opening of the cytoplasmic half by protein-protein interactions, similar to what has been observed for the M-to-N transition in bR under certain conditions .

  • Influence of Structural Features: The bent cytoplasmic part of helix E in cR3 creates a large cavity between helices E and F, potentially facilitating the formation of a linear water cluster in the cytoplasmic inter-helical space. This structural feature may contribute to differences in the later stages of the photocycle, particularly in the formation of the N state .

These kinetic differences provide valuable insights into the structure-function relationships in archaeal rhodopsins and highlight the unique properties of cR3 that might be exploited in various research applications.

What factors affect the photostability of cR3, and how can it be optimized for research applications?

Several factors have been identified that influence the photostability of cR3, with important implications for optimizing its use in research:

  • Oligomeric State: The trimeric assembly of cR3 significantly enhances its photostability. Experimental observations indicate that photobleaching of retinal, which rarely occurs in the native membrane state, becomes pronounced when the trimeric assembly is dissociated into monomers through excess detergent treatment. Maintaining the trimeric structure is therefore crucial for applications requiring prolonged illumination .

  • Lipid Environment: The native protein-lipid interactions appear to play an important role in stabilizing cR3 against photobleaching. When these interactions are disrupted, photostability decreases. For research applications, reconstitution into lipid environments that mimic the native membrane composition may help preserve stability .

  • Detergent Selection: The choice and concentration of detergent used during purification significantly impact cR3's photostability. Excess detergent can dissociate the trimeric assembly into monomers, compromising stability. Using minimal amounts of mild detergents and carefully controlling detergent:protein ratios is recommended .

  • Presence of Carotenoids: The binding of bacterioruberin or similar carotenoids to the inter-subunit crevice may provide additional photoprotection. Including these compounds during reconstitution or purification might enhance photostability in experimental systems .

  • pH and Ionic Strength: Environmental conditions can influence both protein stability and photochemistry. Optimization of buffer conditions (particularly pH and salt concentration) for specific applications should be empirically determined.

For applications requiring enhanced photostability, strategies might include engineering stronger inter-subunit interactions, covalent cross-linking of trimeric assemblies, or incorporation of additional photoprotective elements inspired by natural systems like xanthorhodopsin .

How does the proton pumping mechanism of cR3 compare with other archaeal rhodopsins?

The proton pumping mechanism of cR3 shares fundamental similarities with other archaeal rhodopsins while exhibiting several distinctive features:

  • Conserved Proton-Release Pathway: The structure of the proton-release pathway is generally conserved among proton-pumping archaeal rhodopsins, including cR3. This conservation reflects the fundamental mechanism by which these proteins translocate protons across the membrane in response to light .

  • Water Molecule Positioning: In the unphotolyzed state of cR3, a water molecule is already present in the vicinity of Arg179 (corresponding to Lys215 in halorhodopsin, pHR). This pre-positioned water may facilitate the formation of a linear water cluster in the cytoplasmic inter-helical space during the photocycle, potentially accelerating the formation of the N state compared to bR .

  • Cytoplasmic Cavity Structure: The significantly bent cytoplasmic part of helix E in cR3 creates a large cavity between helices E and F. This structural feature likely influences the proton uptake process, potentially altering the kinetics and energetics of this step in the proton-pumping cycle .

  • Photochemical Implications: The distinct photoreaction kinetics of cR3, particularly the slower decay of the K state and extended lifetime of the M state in certain conditions, suggest differences in the energy landscape of the photocycle compared to bR. These kinetic differences may reflect varying efficiencies or mechanisms in specific steps of the proton-pumping process .

  • Potential for Conformational Flexibility: The inter-subunit crevice in the trimeric assembly of cR3 is filled with lipid components, which may allow for greater flexibility in the cytoplasmic half of the protein during the proton-pumping cycle. This flexibility could be important for the large structural changes that accompany proton translocation .

Understanding these mechanistic differences provides insights for engineering modified versions of cR3 with altered spectral properties, kinetics, or ion selectivity for specific research applications.

How can recombinant cR3 be utilized in optogenetic applications?

Recombinant cR3 offers several promising advantages for optogenetic applications, particularly as a neuron silencer:

  • Powerful Silencing Capability: cR3 functions as a potent neuron silencer due to its efficient proton-pumping activity. When expressed in neurons, it can rapidly hyperpolarize the membrane potential in response to light stimulation, effectively inhibiting action potential firing with high temporal precision .

  • Spectral Tuning Potential: Based on its unique structural features, cR3 provides a valuable template for engineering variants with altered spectral properties. This could allow for the development of optogenetic tools activated by different wavelengths of light, enabling multiplexed control of neural activity in combination with other optogenetic actuators .

  • Enhanced Photostability: The superior photostability of cR3 compared to bacteriorhodopsin, particularly in its trimeric form, makes it potentially advantageous for applications requiring prolonged or repeated light stimulation. This property could reduce the degradation of optogenetic tools during extended experimental protocols .

  • Structural Engineering Platform: The detailed structural information available for cR3 provides a foundation for rational design of improved variants. By targeting specific residues or structural elements, researchers could engineer versions with enhanced expression in mammalian cells, improved trafficking to the plasma membrane, or altered kinetic properties suited to specific experimental requirements .

For optimal implementation in optogenetic applications, several considerations should be addressed, including codon optimization for mammalian expression, addition of trafficking signals to ensure proper membrane localization, and potential fusion with fluorescent reporters for visualization of expression patterns.

What are the current challenges in cR3 research and promising future directions?

Despite significant advances in understanding cR3, several challenges and promising research directions remain:

  • Mammalian Expression Optimization: While cR3 has been successfully expressed in bacterial systems, optimizing its expression in mammalian cells for neuroscience applications remains challenging. Future research could focus on codon optimization, membrane trafficking enhancement, and reducing potential cytotoxicity.

  • Structure-Function Relationship Clarification: Although the crystal structure provides valuable insights, the precise relationship between cR3's unique structural features and its photochemical properties is not fully understood. Further mutagenesis studies targeting specific residues could help elucidate these connections .

  • Role of Carotenoids: The potential role of bacterioruberin or other carotenoids as antenna molecules for energy transfer to retinal remains speculative. Spectroscopic investigations of energy transfer between carotenoids and retinal in native and reconstituted systems could clarify this function .

  • Engineering Enhanced Variants: Developing cR3 variants with red-shifted absorption spectra would enable deeper tissue penetration in optogenetic applications. Similarly, variants with altered kinetics (faster or slower photocycles) could provide more versatile tools for different experimental contexts .

  • Comparative Dynamics Studies: Time-resolved structural studies comparing the conformational changes during the photocycles of cR3 and other rhodopsins could reveal mechanistic insights into the distinct kinetic properties observed spectroscopically .

  • Lipid-Protein Interaction Analysis: The impact of specific lipids on cR3 structure, stability, and function remains incompletely characterized. Systematic studies of reconstituted cR3 in defined lipid environments could provide valuable insights into these interactions .

Progress in these areas would not only advance our fundamental understanding of this interesting archaeal rhodopsin but also enhance its utility for applications in optogenetics, biosensing, and biomimetic energy conversion systems.

What methodological approaches are most effective for comparative analysis between cR3 and other rhodopsins?

For comprehensive comparative analysis between cR3 and other rhodopsins, several complementary methodological approaches are particularly effective:

  • Integrated Structural Analysis: Combining X-ray crystallography data (as achieved with the membrane fusion method yielding 2.1 Å resolution for cR3) with computational modeling allows detailed comparison of structural elements that may contribute to functional differences. Key structural features like the DE loop, helix bending, and retinal binding pocket can be systematically compared across rhodopsin types .

  • Time-Resolved Spectroscopy: Flash photolysis with multiwavelength detection provides detailed kinetic information about the photocycle intermediates. The photoreaction kinetics of cR3, which show significant differences from bacteriorhodopsin (particularly in the K-state decay rate and M-state properties), can be fitted with exponential components and compared across different rhodopsins under standardized conditions .

  • Detergent Sensitivity Assays: Comparative analysis of how different rhodopsins respond to detergent treatment reveals important insights about oligomeric stability. The significant increase in photobleaching observed when cR3 trimers are dissociated into monomers with excess detergent provides valuable information about structure-stability relationships .

  • Reconstitution Studies: Systematic reconstitution of purified rhodopsins into defined lipid environments allows controlled comparison of their functional properties. Measuring parameters like proton pumping efficiency, spectral properties, and photostability in matched reconstituted systems enables direct functional comparisons isolated from differences in native membrane environments.

  • Mutation Analysis: Creating equivalent mutations across different rhodopsins and analyzing the resulting effects on structure and function can identify conserved mechanistic elements versus rhodopsin-specific features. This approach is particularly powerful for understanding the functional significance of unique structural elements in cR3 .

These methodological approaches, when applied systematically across different rhodopsin types, can yield comprehensive insights into the structure-function relationships that underlie their distinct properties, ultimately informing both fundamental understanding and application-oriented protein engineering efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.