Recombinant Haloarcula vallismortis Sensory rhodopsin-2 (sop2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will accommodate your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
sop2; sopII; Sensory rhodopsin-2; Sensory rhodopsin II; SR-II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Haloarcula vallismortis (Halobacterium vallismortis)
Target Names
sop2
Target Protein Sequence
MATITTWFTLGLLGELLGTAVLAYGYTLVPEETRKRYLLLIAIPGIAIVAYALMALGFGS
IQSEGHAVYVVRYVDWLLTTPLNVWFLALLAGASREDTVKLVVLQALTIVFGFAGAVTPS
PVSYALFAVGGALFGGVIYLLYRNIAVAAKSTLSDIEVSLYRTLRNFVVVLWLVYPVVWL
LGAAGVGLMDVETATLVVVYLDVVTKVGFGVIALLAMIDLGSAGETAEEPTAVAGD
Uniprot No.
Target Background
Function
This photophobic photoreceptor is responsible for negative phototaxis. It activates the sensory rhodopsin II transducer (HTR-II) in response to blue light.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
