Recombinant Halobacterium halobium Halorhodopsin (hop)

Shipped with Ice Packs
In Stock

Description

Homologous Expression

Halobacterium halobium employs the bop (bacterio-opsin) promoter to drive hop gene expression, achieving up to 150,000 copies per cell—matching bacteriorhodopsin levels in native purple membranes . This system yields HR in its native lipid environment, eliminating detergent requirements for isolation .

Heterologous Expression in E. coli

Commercial producers (e.g., Creative BioMart) use codon-optimized hop genes in E. coli with IPTG-inducible promoters . Yields reach 1–5 mg/L culture, with purity >90% confirmed by SDS-PAGE .

Table 1: Recombinant Halorhodopsin Variants

Catalog No.Source SpeciesTagProtein LengthReference
RFL24723HFHalobacterium halobiumHis22–276 aa
RFL33319HFHalobacterium halobiumHis1–206 aa
RFL26000NFNatronomonas pharaonisHis1–291 aa

Functional Insights from Mutagenesis Studies

Critical residues were identified through site-directed mutagenesis:

Table 2: Functional Impact of Key Mutations

MutationChloride AffinityTransport ActivityPhotocycle AlterationReference
R108AAbolishedInactiveLoss of anion-specific K/L intermediates
T203VUnchangedReduced by 80%Delayed N intermediate decay
Q105EIncreasedNormalAccumulation of red-shifted L intermediate
  • Arg108: Essential for anion binding; substitutions (R108H/I) reduce expression 5-fold .

  • Thr203: Facilitates cytoplasmic chloride release; mutations slow photocycling by 3x .

Photocycle Dynamics

The chloride-dependent photocycle follows:
HRhνKL1L2NHR\text{HR} \xrightarrow{h\nu} \text{K} \leftrightarrow \text{L}_1 \leftrightarrow \text{L}_2 \leftrightarrow \text{N} \rightarrow \text{HR}

  • K intermediate: Forms within 1 µs, retinal isomerization to 13-cis .

  • N intermediate: Chloride release occurs here (t₁/₂ = 10 ms at 2 M NaCl) .

  • Chloride dependence: Cycle kinetics are unchanged across 20 mM–2 M Cl⁻, indicating high-affinity binding .

Research-Grade Products

  • ELISA kits: Detect HR at 0.1–10 ng/mL sensitivity using anti-His tag antibodies .

  • Membrane fractions: Isolated HR in native lipids ($1,604/50 µg) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
hop; Halorhodopsin; HR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-276
Protein Length
Full Length of Mature Protein
Species
Halobacterium halobium (strain port)
Target Names
hop
Target Protein Sequence
EIQSNFLLNSSIWVNIALAGVVILLFVAMGRDIESPRAKLIWVATMLVPLVSISSYAGLA SGLTVGFLQMPPGHALAGQEVLSPWGRYLTWTFSTPMILLALGLLADTDIASLFTAITMD IGMCVTGLAAALITSSHLLRWVFYGISCAFFVAVLYVLLVQWPADAEAAGTSEIFGTLKI LTVVLWLGYPILWALGSEGVALLSVGVTSWGYSGLDILAKYVFAFLLLRWVAANEGAVSG SGMSIGSGGAAPADD
Uniprot No.

Target Background

Function
Light-driven chloride pump.
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is halorhodopsin and how does it differ from bacteriorhodopsin in Halobacterium halobium?

Halorhodopsin (HR) is a light-driven chloride pump found in Halobacterium halobium (now often referred to as Halobacterium salinarum). Unlike bacteriorhodopsin (BR), which functions as a light-driven proton pump that transports protons outward, halorhodopsin transports chloride ions inward. This fundamental difference in ion specificity and directionality results from key amino acid differences in the respective protein structures. Halorhodopsin requires high salt concentrations (>2 M NaCl) for preservation of its native structure and function, reflecting its adaptation to the extreme halophilic environment of its host organism . The protein exists as an oligomer in both membrane-bound and isolated forms, as evidenced by its characteristic bilobed CD spectrum in the visible region . For experimental isolation, halorhodopsin can be purified from cell envelope vesicles using detergent solubilization followed by column chromatography techniques while maintaining high salt conditions throughout the process.

What expression systems are available for recombinant halorhodopsin production?

Recombinant halorhodopsin can be expressed using several systems, with the choice depending on experimental requirements. Halobacterium halobium itself serves as an effective homologous expression system, as demonstrated by similar gene replacement methods used for bacteriorhodopsin . This approach involves integrating selectable plasmids carrying the halorhodopsin gene at the chromosomal locus, followed by isolation of recombinants under non-selective conditions. The homologous expression approach offers the advantage of native post-translational modifications and proper membrane integration. Alternative heterologous expression systems include Escherichia coli, which has been successfully employed for sensory rhodopsins from Halobacterium . When using E. coli, researchers must carefully optimize codon usage, consider the addition of a leader sequence to facilitate membrane targeting, and implement appropriate purification strategies that maintain the high salt requirements of this halophilic protein.

How do I isolate and purify functional halorhodopsin from Halobacterium halobium?

The isolation of functional halorhodopsin requires maintaining high salt conditions throughout the purification process. A validated protocol involves:

  • Preparation of cell envelope vesicles from Halobacterium halobium cultures

  • Washing these vesicles with Tween-20 to remove approximately 80% of contaminating proteins

  • Solubilization of the remaining membrane fraction using 0.5% C12E9 detergent, which preserves the photochemical activities of halorhodopsin

  • Sequential chromatography through hydroxyapatite and phenyl-Sepharose columns while maintaining 2M NaCl and 0.5% C12E9 conditions

This approach yields purified halorhodopsin with an absorption maximum at 578 nm and a ratio of absorbance at 280 nm to 580 nm of approximately 1.52 . The apparent molecular weight of the purified protein is approximately 20,000 Da as determined by SDS-PAGE. It is crucial to avoid low salt conditions at any stage of purification as this will lead to irreversible denaturation of this halophilic protein.

How can site-directed mutagenesis be applied to investigate halorhodopsin function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in halorhodopsin. Drawing from techniques established for bacteriorhodopsin mutants in Halobacterium halobium, researchers can develop similar gene replacement methods for halorhodopsin . This approach begins with designing a synthetic gene optimized with unique restriction sites that facilitate cassette mutagenesis, similar to the strategy used for sensory rhodopsin I . Key residues for mutation should include those suspected to participate in chloride binding and transport, proton coupling, and conformational changes during the photocycle.

The experimental approach would involve:

  • Designing a synthetic halorhodopsin gene with strategically placed restriction sites

  • Placing this gene under control of a strong promoter on a selectable vector

  • Creating a halorhodopsin deletion strain through homologous recombination

  • Transforming this strain with vectors containing various mutant constructs

  • Assessing functional changes through spectroscopic and transport assays

This methodology allows for systematic analysis of amino acid contributions to chloride transport and photochemical properties, providing insights into the molecular mechanism of halorhodopsin function.

What spectroscopic techniques are most informative for characterizing halorhodopsin photocycle intermediates?

Multiple spectroscopic approaches can provide complementary information about halorhodopsin photocycle intermediates:

TechniqueInformation ProvidedTechnical Considerations
UV/Visible SpectroscopyAbsorption maxima shifts during photocycleRequires high-quality samples with minimal light scattering
Time-Resolved SpectroscopyKinetics of intermediate formation and decayRequires specialized equipment for microsecond to millisecond resolution
FTIR SpectroscopyProtein structural changes and protonation statesRequires careful sample preparation in D2O or H2O
Resonance Raman SpectroscopyChromophore configuration changesRequires precise laser wavelength selection
CD SpectroscopyOligomeric state and structural informationCan confirm native folding of recombinant protein

When characterizing halorhodopsin photocycle intermediates, it's essential to control experimental conditions carefully, particularly pH and salt concentration, as these factors significantly influence the photocycle kinetics. Comparisons between wild-type and mutant proteins can reveal the specific roles of amino acid residues in the transport mechanism. Based on studies with bacteriorhodopsin mutants, researchers should expect potential 10-50 nm shifts in absorption maxima for certain halorhodopsin mutants, particularly those affecting the ion binding pocket .

How can electrophysiological approaches be utilized to measure halorhodopsin function?

Electrophysiological approaches provide direct measurements of halorhodopsin-mediated chloride transport. Key methodologies include:

  • pH-dependent photocurrent measurements: Similar to those used for bacteriorhodopsin, these can determine the optimal functional pH range for halorhodopsin .

  • Patch-clamp recordings: In heterologous expression systems or reconstituted membranes, this technique allows direct measurement of light-induced currents.

  • Ion-sensitive electrode recordings: These can measure changes in ion concentrations during halorhodopsin activation, as demonstrated for potassium measurements in optogenetic applications .

When designing electrophysiological experiments, researchers should consider that halorhodopsin activation can cause secondary ion movements, including potassium redistribution . Additionally, as demonstrated with dual-bacteriorhodopsin systems, different optimal functional pH ranges may exist for halorhodopsin variants . Experimental designs should account for these factors by carefully controlling buffer composition and including appropriate controls for indirect effects.

What are common issues in recombinant halorhodopsin expression and how can they be resolved?

Several challenges commonly arise during recombinant halorhodopsin expression and purification:

IssuePotential CausesSolutions
Low expression levelsPromoter inefficiency, protein toxicityOptimize promoter strength, use inducible systems, adjust growth conditions
Improper membrane insertionMissing targeting sequencesInclude appropriate signal sequences from bacterioopsin
Protein instabilityInsufficient salt concentrationMaintain >2M NaCl throughout all purification steps
Loss of chromophoreRetinal deficiency, improper foldingSupplement growth media with retinal, optimize folding conditions
AggregationDetergent incompatibilityTest alternative detergents; C12E9 has been shown effective for halorhodopsin

When troubleshooting expression issues, it's valuable to implement tracking methods such as antibody detection. While commercial antibodies against halorhodopsin from Natronomonas pharaonis exist , they may not cross-react with Halobacterium halobium halorhodopsin. Developing specific antibodies or incorporating epitope tags may be necessary for detection and tracking during expression and purification processes.

How can researchers distinguish between direct and indirect effects when studying halorhodopsin function in complex systems?

Distinguishing direct from indirect effects of halorhodopsin activation presents a significant challenge, particularly in complex systems. Research with halorhodopsin in neuronal systems has revealed that strong activation can cause secondary ion movements beyond the primary chloride transport function . To differentiate direct from indirect effects:

  • Implement appropriate controls: Include non-expressing cells or inactive halorhodopsin mutants in parallel experiments.

  • Measure multiple ion species: Monitor changes in chloride and potassium concentrations simultaneously using ion-sensitive electrodes .

  • Temporal analysis: Direct transport effects occur rapidly after illumination, while secondary effects may develop more slowly.

  • Pharmacological dissection: Use specific ion channel blockers to isolate pathways involved in observed effects.

  • Computational modeling: Develop models that account for both primary ion transport and secondary ion redistribution.

Research has shown that halorhodopsin activation can lead to K+ redistribution into cells during hyperpolarization, and clearance of Cl- coupled to K+ by the potassium-chloride cotransporter KCC2 after illumination ends . These secondary effects must be carefully controlled for when interpreting experimental results.

What analytical approaches can resolve data inconsistencies in halorhodopsin research?

When facing data inconsistencies in halorhodopsin research, systematic analytical approaches include:

  • Standardization of experimental conditions: Ensure uniform salt concentration, pH, and temperature across all experiments, as halorhodopsin function is highly sensitive to these parameters .

  • Multiple measurement techniques: Combine spectroscopic, electrophysiological, and biochemical approaches to build a comprehensive understanding.

  • Statistical analysis: Implement appropriate statistical tests to determine if observed differences are significant or within experimental variation.

  • Protein quality assessment: Verify protein integrity through multiple metrics including absorption spectra ratios, CD spectra, and functional assays.

  • Time-resolved measurements: Account for temporal aspects of halorhodopsin function, as transient effects may explain apparent inconsistencies between steady-state measurements.

Additionally, researchers should consider environmental adaptation effects. Different halorhodopsins may have evolved functional optimizations for specific environmental conditions, as seen with the dual-bacteriorhodopsin system in Haloarcula marismortui that covers different optimal pH ranges .

How does halorhodopsin compare with other microbial rhodopsins as an optogenetic tool?

Halorhodopsin has become a valuable optogenetic tool due to its ability to silence neuronal activity through light-activated chloride transport. When comparing halorhodopsin with other microbial rhodopsins:

RhodopsinPrimary FunctionOptogenetic ApplicationAdvantagesLimitations
Halorhodopsin (HR)Inward Cl- pumpNeuronal silencingCompatible with cation channelrhodopsinsRequires high light intensity, may cause ion redistribution
Bacteriorhodopsin (BR)Outward H+ pumpNeuronal silencingWell-characterizedLess efficient silencing than HR
Channelrhodopsin (ChR)Cation channelNeuronal activationRapid kineticsCannot silence neurons
Archaerhodopsin (Arch)Outward H+ pumpNeuronal silencingHigher photocurrents than HRpH effects

Recent research has revealed important considerations when using halorhodopsin for optogenetics. Strong halorhodopsin activation can cause cortical spreading depolarizations both in vitro and in vivo, which is a novel finding that researchers should account for in experimental design . Additionally, halorhodopsin activation leads to secondary K+ redistribution into cells, resulting in a 2-3 mV hyperpolarization even in cells that do not express halorhodopsin . These effects highlight the complexity of using microbial ion pumps in mammalian systems.

What innovative approaches combine halorhodopsin with other systems for enhanced functionality?

Innovative research approaches are combining halorhodopsin with complementary systems to create enhanced experimental tools:

  • Dual-optogenetic systems: Pairing halorhodopsin with cation channelrhodopsins that respond to different wavelengths allows bidirectional control of cellular activity.

  • Coupled sensors: Combining halorhodopsin with fluorescent chloride or voltage sensors enables simultaneous manipulation and measurement of cellular states.

  • Conditional expression systems: Implementing cell-type-specific or activity-dependent expression of halorhodopsin provides precise targeting of intervention.

  • Structural biology integration: Applying techniques from bacteriorhodopsin studies, such as optimized gene replacement methods , to create tailored halorhodopsin variants with specific properties.

  • Multi-rhodopsin systems: Drawing inspiration from natural systems like the dual-bacteriorhodopsin system in Haloarcula marismortui , researchers are developing complementary rhodopsin pairs that function optimally under different conditions.

These combination approaches leverage the understanding gained from studying the native function of halorhodopsin in Halobacterium halobium to create sophisticated tools for neuroscience and cell biology research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.