Recombinant Halobacterium salinarum Bacteriorhodopsin (bop)

Shipped with Ice Packs
In Stock

Description

2.1. Heterologous Expression in Escherichia coli

  • Mistic-bO hybrid protein: A fusion strategy using the Bacillus subtilis Mistic protein enables high-yield BR production (~120 mg/L) in E. coli. The method includes detergent solubilization, thrombin cleavage, and retinal reconstitution .

  • N-terminal modifications: Inclusion of 17 N-terminal residues omitted in early annotations is critical for functional expression .

2.2. Homologous Expression in H. salinarum

  • Purple membrane-deficient strains: H. salinarum L33, lacking native bop, is transformed with plasmids carrying wild-type or mutant bop genes. This system yields ~1.5 mg of BR per liter of culture .

Comparison of Expression Systems

ParameterE. coli H. salinarum
Yield120 mg/L1.5 mg/L
Chromophore Regeneration100% efficiencyNative retinal integration
Key AdvantageCost-effectiveNative post-translational modifications

Regulatory Mechanisms of bop Expression

  • Brz protein: A zinc finger regulator encoded upstream of bop enhances bop mRNA levels. Deletion reduces bop transcription by >70% .

  • Bat protein: A helix-turn-helix (HTH) transcription factor binds the bop promoter. The Q661R/Q665R double mutation in Bat’s HTH motif increases BR production by 40% under low oxygen .

Functional and Mutagenesis Studies

  • Loop replacements: BC and FG loop substitutions with Gly-Gly-Ser linkers reduce proton-pumping activity and increase SDS sensitivity .

  • Retinal biosynthesis: BR apoprotein (bacterioopsin) inhibits bacterioruberin synthesis, redirecting carotenoid precursors toward retinal production. Deletion of bop increases bacterioruberin levels by 300% .

5.1. Biotechnological Uses

  • Optogenetics and bioelectronics: BR’s light-sensitive properties are leveraged for photocurrent generation .

  • Energy harvesting: BR proteoliposomes generate proton gradients for ATP synthesis in synthetic systems .

5.2. Challenges in Production

  • Protein stability: Mutants lacking AB or EF loops show 50% lower folding yields in micelles .

  • Host compatibility: Haloarcula and Haloferax BRs require distinct promoters for expression in E. coli, limiting cross-species applications .

Future Directions

  • Directed evolution: Optimizing BR variants for enhanced thermal stability (current Tm = 70°C) .

  • Metabolic engineering: Co-expression of retinal biosynthesis genes (crtB1, lye) in E. coli to improve chromophore regeneration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing the order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
bop; VNG_1467G; Bacteriorhodopsin; BR; Bacterioopsin; BO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
14-262
Protein Length
Full Length of Mature Protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
bop
Target Protein Sequence
QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSM LLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIG TGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVV LWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA GDGAAATSD
Uniprot No.

Target Background

Function
Bacteriorhodopsin (bop) is a light-driven proton pump.
Database Links
Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is bacteriorhodopsin and what makes it unique among membrane proteins?

Bacteriorhodopsin (BR) is a 7-transmembrane protein that functions as a light-driven proton pump in the archaeon Halobacterium salinarum. It is unique among membrane proteins due to its covalently bound colored ligand (all-trans retinal) which gives it distinctive photochemical properties . The protein consists of 262 amino acids with a molecular weight of approximately 28,256 Da . What makes bacteriorhodopsin particularly valuable for research is its remarkable stability under extreme conditions, including high temperatures, high salinity, and nutritionally-limited environments . This exceptional stability, combined with its ability to convert light energy into chemical energy through proton pumping, has established bacteriorhodopsin as an important model system for studying membrane protein structure and function.

How does the structure of bacteriorhodopsin relate to its proton-pumping mechanism?

Bacteriorhodopsin's structure consists of seven transmembrane α-helical segments that form a channel through which protons are transported. The retinal chromophore is covalently bound to a lysine residue (Lys216) via a protonated Schiff base, positioned roughly in the middle of the membrane . When bacteriorhodopsin absorbs light, the retinal undergoes photoisomerization from all-trans to 13-cis configuration, triggering a series of conformational changes in the protein. These structural changes facilitate the transfer of a proton from the Schiff base to the extracellular side and subsequently the uptake of another proton from the cytoplasmic side. This directional proton movement generates a proton gradient across the membrane that can be harnessed for ATP synthesis . The protein exhibits an absorption maximum at 560 nm with an extinction coefficient of 63,000 M⁻¹cm⁻¹, which serves as a useful spectroscopic signature for monitoring its functional state .

What is the relationship between the bop gene and bacteriorhodopsin expression?

The bop gene encodes bacteriorhodopsin in Halobacterium salinarum, and its expression is tightly regulated in response to environmental conditions, particularly oxygen levels. Bacteriorhodopsin is optimally expressed under anaerobic growth conditions when the organism needs alternative energy sources beyond oxidative phosphorylation . Regulation of the bop gene involves several factors, including a zinc finger protein called Brz (bacteriorhodopsin-regulating zinc finger protein), which is encoded directly upstream of the bop gene in the same orientation . Research has shown that deletion of the brz gene causes a significant decrease in bop mRNA levels, demonstrating its important regulatory role. Site-directed mutagenesis of cysteine and histidine residues in the zinc finger motif of Brz produces similar effects, highlighting the importance of this structural motif for proper regulation of bacteriorhodopsin expression .

What are the optimal culture conditions for maximizing bacteriorhodopsin production in Halobacterium salinarum?

Optimizing bacteriorhodopsin production requires careful control of several key parameters:

ParameterOptimal ValueImpact on BR Production
Temperature39°CPromotes growth and BR synthesis
Agitation speed150 rpmEnsures proper aeration and mixing
Light intensity6300 luxStimulates BR expression
Nitrogen sourcePeptone from meatProvides essential amino acids

Under these optimized conditions, bacteriorhodopsin yields can reach up to 196 mg/L, which is approximately 4.23-fold greater than yields obtained with basal medium . It's important to note that bacteriorhodopsin expression is strongly influenced by oxygen levels, with anaerobic conditions favoring its production. The archaeon uses bacteriorhodopsin for photosynthesis as an alternative energy generation pathway when oxygen is limited for oxidative phosphorylation . Therefore, controlling dissolved oxygen levels during cultivation is critical for maximizing protein yields.

What purification methods are recommended for isolating high-purity bacteriorhodopsin?

The classical method for bacteriorhodopsin purification follows the protocol described by Oesterhelt and Stoeckenius, involving isolation of the purple membrane followed by fractionation . The procedure typically includes:

  • Cell lysis in low-salt buffer containing DNase to reduce viscosity

  • Removal of cell debris by low-speed centrifugation

  • Collection of membrane fractions by high-speed centrifugation

  • Separation of purple membrane (containing bacteriorhodopsin) from red membrane using sucrose density gradient centrifugation

  • Washing of purple membrane fragments to remove contaminants

The purple membrane patches obtained through this method contain bacteriorhodopsin at high purity (>95% as determined by SDS-PAGE) . The purity can be assessed spectroscopically by measuring the absorbance ratio at 280 nm (protein) and 560 nm (retinal-bound bacteriorhodopsin), with a ratio of approximately 2.3 indicating high purity . For researchers requiring even higher purity, additional purification steps such as ion-exchange chromatography or gel filtration may be employed.

How can I verify the functional integrity of purified bacteriorhodopsin?

Assessing the functional integrity of purified bacteriorhodopsin involves several complementary approaches:

  • Spectroscopic analysis: Functional bacteriorhodopsin exhibits a characteristic absorption maximum at 560 nm due to the retinal chromophore. The absorbance ratio A280/A560 should be approximately 2.3 for high-purity, functional protein .

  • Photocycle measurements: Time-resolved spectroscopy can be used to monitor the photocycle intermediates (K, L, M, N, and O states) that form upon light activation. The presence of all intermediates with appropriate kinetics indicates properly functioning bacteriorhodopsin.

  • Proton pumping assays: Functional bacteriorhodopsin should demonstrate light-dependent proton translocation when reconstituted into liposomes or when present in purple membrane patches. This can be measured using pH-sensitive dyes or electrode-based methods.

  • Structural integrity assessment: Circular dichroism spectroscopy can verify the alpha-helical secondary structure characteristic of properly folded bacteriorhodopsin.

Any significant deviations from expected results may indicate protein denaturation, loss of the retinal chromophore, or structural alterations that impair function.

How can recombinant bacteriorhodopsin be used as a model system for membrane protein research?

Bacteriorhodopsin serves as an excellent model system for membrane protein research due to several key advantages:

  • Crystallization studies: Due to its stability and ability to form ordered arrays in the purple membrane, bacteriorhodopsin is widely used as a control in membrane protein crystallization assays . Researchers can compare crystallization conditions and techniques with this well-characterized protein before applying them to more challenging membrane protein targets.

  • Biophysical characterization methods: Bacteriorhodopsin provides a reliable system for developing and validating new biophysical techniques for membrane protein analysis, including spectroscopic methods, atomic force microscopy, and electron crystallography.

  • Lipid-protein interactions: The protein can be used to study how membrane lipids influence protein structure, stability, and function – a critical aspect of membrane protein biology.

  • Protein folding studies: Bacteriorhodopsin has been used extensively to investigate the mechanisms of membrane protein folding, insertion, and assembly.

  • Structure-function relationships: The well-defined relationship between bacteriorhodopsin's structure and its proton-pumping function makes it valuable for studying how specific mutations affect membrane protein function.

When using bacteriorhodopsin as a model system, researchers should consider working with both native protein isolated from H. salinarum and recombinant versions expressed in various systems to address specific research questions.

What advanced spectroscopic techniques are most valuable for studying bacteriorhodopsin dynamics?

Several sophisticated spectroscopic approaches have proven particularly valuable for investigating bacteriorhodopsin dynamics:

  • Time-resolved absorption spectroscopy: This technique allows monitoring of the bacteriorhodopsin photocycle with microsecond to millisecond resolution, revealing the kinetics of the various intermediates and how they are affected by mutations or environmental conditions.

  • Resonance Raman spectroscopy: This method provides detailed information about the vibrational modes of the retinal chromophore and its interactions with the protein environment during the photocycle. Surface-enhanced Raman scattering (SERS) using silver nanoparticles has been shown to significantly enhance the signal and provide information about bacteriorhodopsin molecules in specific regions .

  • Fourier transform infrared (FTIR) spectroscopy: Difference FTIR spectroscopy can track subtle conformational changes in the protein backbone and side chains during the photocycle.

  • Solid-state NMR spectroscopy: This approach provides atomic-level insights into the structure and dynamics of bacteriorhodopsin in its native membrane environment without the need for crystallization.

  • Fluorescence spectroscopy with site-specific labels: By introducing fluorescent probes at specific sites in bacteriorhodopsin, researchers can monitor local conformational changes during function.

Each of these techniques offers complementary information, and their combination provides a comprehensive view of the structural dynamics underlying bacteriorhodopsin's proton-pumping mechanism.

What genetic modifications can enhance bacteriorhodopsin expression or alter its functional properties?

Several genetic strategies have been employed to manipulate bacteriorhodopsin expression and function:

  • Promoter engineering: Modifying the native promoter or using stronger promoters can increase bacteriorhodopsin expression levels. Understanding the role of regulatory proteins like Brz (bacteriorhodopsin-regulating zinc finger protein) is crucial for this approach .

  • Codon optimization: Adapting the codon usage of the bop gene to match the preferred codons of the expression host can significantly improve translation efficiency and protein yields.

  • Site-directed mutagenesis: Specific amino acid substitutions can alter bacteriorhodopsin's spectral properties, photocycle kinetics, and proton-pumping efficiency. Key targets include residues in the retinal binding pocket, the proton translocation pathway, and regions involved in conformational changes.

  • Fusion proteins: Creating fusion constructs with affinity tags or fluorescent proteins can facilitate purification and enable new applications, though care must be taken to ensure these modifications don't disrupt function.

  • Expression system optimization: While native expression in H. salinarum remains important, heterologous expression systems can be engineered for specific research needs, though they often require extensive optimization due to the unique lipid requirements and extreme conditions preferred by this archaeal protein.

When implementing these modifications, it's essential to verify that the altered bacteriorhodopsin retains its proper folding, chromophore binding, and functional properties through spectroscopic and functional assays.

What are common issues encountered when working with bacteriorhodopsin and how can they be addressed?

Researchers commonly encounter several challenges when working with bacteriorhodopsin:

  • Low expression yields: If bacteriorhodopsin production is suboptimal, ensure proper anaerobic conditions, verify light intensity (aim for 6300 lux), maintain optimal temperature (39°C), and use appropriate agitation speed (150 rpm) . Also check that the nitrogen source (peptone from meat has been shown to be effective) and salt concentration are optimal for H. salinarum growth.

  • Loss of the retinal chromophore: This is often indicated by a shift in absorption spectrum and loss of the purple color. To address this, ensure samples are protected from strong light exposure during purification and storage. Adding excess all-trans retinal can sometimes help reconstitute the holoprotein.

  • Protein aggregation: If bacteriorhodopsin aggregates during purification or storage, optimize buffer conditions (salt concentration, pH), consider adding stabilizing agents like glycerol, and ensure appropriate detergent concentration if the protein is extracted from purple membrane.

  • Functional heterogeneity: Variations in the photocycle or proton-pumping efficiency may indicate a mixture of functional states. Careful control of pH during experiments is critical, as the photocycle is highly pH-dependent. Additionally, ensure complete regeneration between measurements if using light-activation protocols.

  • Contamination with other membrane proteins: If spectroscopic analysis indicates impurities (abnormal A280/A560 ratio), refine the purification protocol, particularly the sucrose gradient centrifugation step that separates purple membrane from other cellular components.

Maintaining detailed records of growth conditions, purification procedures, and storage methods is essential for troubleshooting and ensuring reproducibility in bacteriorhodopsin research.

How should bacteriorhodopsin samples be properly stored to maintain their functional integrity?

Proper storage of bacteriorhodopsin is crucial for maintaining its structural and functional integrity:

Regular quality control checks using absorption spectroscopy (monitoring the characteristic 560 nm peak) are recommended to verify sample integrity before conducting experiments, especially with older samples.

How is bacteriorhodopsin being integrated into biophysical and nanotechnological applications?

Bacteriorhodopsin's unique properties have led to its incorporation into various advanced applications:

  • Bioelectronic devices: The protein's ability to generate a potential difference upon light activation makes it valuable for creating bioelectronic interfaces, biosensors, and biocomputing elements.

  • Artificial photosynthetic systems: Bacteriorhodopsin can be integrated into artificial systems that aim to convert light energy into chemical energy, potentially contributing to sustainable energy research.

  • Optogenetic tools: Modified versions of bacteriorhodopsin are being explored as potential optogenetic actuators for controlling membrane potential in target cells.

  • Biomolecular materials: The protein's ability to form two-dimensional crystalline arrays has inspired its use in creating ordered biomolecular materials with defined optical and electrical properties.

  • Model systems for membrane protein dynamics: Advanced biophysical studies of bacteriorhodopsin continue to provide insights into fundamental aspects of membrane protein function that can be applied to understanding other, more complex membrane proteins.

When adapting bacteriorhodopsin for these applications, researchers must carefully consider its stability under the required experimental conditions and often need to develop specialized immobilization or integration strategies to maintain its functionality in artificial environments.

What recent advances have been made in understanding the regulatory mechanisms of bacteriorhodopsin expression?

Recent research has revealed sophisticated regulatory mechanisms controlling bacteriorhodopsin expression:

  • Zinc finger regulators: The identification of Brz (bacteriorhodopsin-regulating zinc finger protein) has provided crucial insights into bop gene regulation. This small protein with a zinc finger motif is encoded directly upstream of the bop gene and is essential for high-level bacteriorhodopsin expression . Deletion of the brz gene or mutation of its zinc finger motif significantly reduces bop mRNA levels.

  • Oxygen-dependent regulation: Bacteriorhodopsin expression is inversely correlated with oxygen availability, being optimally expressed under anaerobic conditions. This allows H. salinarum to switch between oxidative phosphorylation and bacteriorhodopsin-driven photosynthesis depending on environmental oxygen levels .

  • Growth rate coordination: Recent evidence suggests that bacteriorhodopsin expression may be coordinated with cellular growth rate, potentially through global regulatory networks that integrate various metabolic pathways .

  • Archaeal transcription regulation: Studies of bacteriorhodopsin regulation have contributed to understanding archaeal transcription regulation more broadly, revealing both unique archaeal mechanisms and some similarities to bacterial and eukaryotic systems .

These regulatory insights provide opportunities for genetic engineering approaches to enhance bacteriorhodopsin production and may inform strategies for expressing other challenging membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.