Recombinant Halobacterium salinarum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Halobacterium salinarum Cobalamin Synthase (cobS)

Cobalamin synthase (cobS) is an enzyme involved in the biosynthesis of cobalamin, also known as vitamin B12 . Cobalamin is an essential cofactor required by many organisms across all domains of life . It is a complex metabolite produced only by a subset of bacteria and archaea . Recombinant Halobacterium salinarum Cobalamin synthase (cobS) refers to the Cobalamin synthase enzyme that is produced using recombinant DNA technology in Halobacterium salinarum .

Biosynthesis Pathway of Cobalamin

Cobalamin biosynthesis involves a complex pathway that can proceed either aerobically or anaerobically, starting from uroporphyrinogen III, a precursor molecule . This pathway involves approximately 20 enzymatic steps . Several enzymes are homologous and shared by both pathways, while only a few are specifically oxygen-requiring or oxygen-sensitive .

Key points regarding the cobalamin biosynthesis pathway:

  • The Halonotius genus contains almost all genes involved in aerobic and anaerobic pathways, with only a few gaps (i.e., CobG and CobK were missing from the aerobic pathway; CbiD and CbiJ were missing from the anaerobic pathway) .

  • All genes encoding the conversion of cobyrinic acid a,c-diamide to vitamin B12 were also found and are represented by a discontinuous line on the metabolic map .

  • The presence of cbiA/ cobB, cbiC/ cobH or cobT genes in a microorganism are reliable indicators for the complete pathway .

Role of Halobacterium salinarum in Cobalamin Production

Halobacterium salinarum is a halophilic archaeon known for its ability to thrive in hypersaline environments . Although Halobacterium salinarum NRC-1 cobamide production has been reported, little is known about the cobalamin biosynthesis pathway in hypersaline environments or halophilic archaea at large . Some studies suggest that species within the Halonotius genus could play a significant environmental role in de novo cobalamin synthesis in saline environments and perform a Black Queen function among members of the haloarchaea in hypersaline habitats .

Importance of cobS in Halobacterium salinarum

The cobS gene encodes Cobalamin synthase, an enzyme crucial for the completion of cobalamin biosynthesis . Halophilic archaea such as Halobacterium salinarum possess unique strategies for cobalamin production and salvaging . Mutants of Halobacterium lacking cbiP were auxotrophic for adenosylcobyric acid but could still salvage cobinamide, suggesting an alternative salvaging pathway in this archaeon .

Characteristics of Recombinant Halobacterium salinarum Cobalamin synthase (cobS)

Recombinant Cobalamin synthase (cobS) is produced in a laboratory setting using genetic engineering techniques . The general characteristics include:

ItemDescription
Source/Expression SystemCell Free Expression
Domain/Region/Terminus1-199aa; full length protein
TypeRecombinant Protein
ProteinCobalamin synthase (cobS)
PurityGreater or equal than 85% purity as determined by SDS-PAGE
Molecular Weight18,974 Da
Quantity0.02 mg, 50 ug (other sizes are also available)
FormatLiquid containing glycerol
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
SequenceMLAGGVPHGT VAFAYLAVVF AVTGINHLDG VADAGDAAVV HGDPADRRTV LKDTTTGVGA IAAVVVVVAG LVTGSLGVAA LPTWTAVGVV VATEVGAKTS MAAVACLAHA PHDGLGSQFT GNATPGALPA VAGVALPVAL ASVPSPAAAG ALAGAVGAGA LTRRWLTGLL GGANGDVFGA VNEVSRVVGL HAGVVVWTL
SpeciesHalobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
UniProt No.Q9HPL2

Applications and Research Findings

Recombinant Halobacterium salinarum Cobalamin synthase (cobS) is used in various research applications:

  • Understanding Cobalamin Biosynthesis: Studying the enzyme helps elucidate the detailed mechanisms of cobalamin production in archaea .

  • Metabolic Engineering: Recombinant cobS can be utilized to enhance cobalamin production in microbial systems .

  • Enzyme Characterization: Biochemical assays using the recombinant enzyme provide insights into its catalytic properties, substrate specificity, and regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; VNG_1580H; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
cobS
Target Protein Sequence
MLAGGVPHGTVAFAYLAVVFAVTGINHLDGVADAGDAAVVHGDPADRRTVLKDTTTGVGA IAAVVVVVAGLVTGSLGVAALPTWTAVGVVVATEVGAKTSMAAVACLAHAPHDGLGSQFT GNATPGALPAVAGVALPVALASVPSPAAAGALAGAVGAGALTRRWLTGLLGGANGDVFGA VNEVSRVVGLHAGVVVWTL
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How does the cobalamin biosynthesis pathway in Halobacterium salinarum differ from bacterial pathways?

    The cobalamin biosynthesis pathway in Halobacterium salinarum and other archaea differs significantly from the bacterial pathway, particularly in terms of salvaging cobinamide (Cbi). While bacteria utilize nucleoside diphosphate kinases and adenosyltransferases encoded by cobU, archaea lack these enzymes and instead employ a novel salvaging mechanism .

    In H. salinarum, genetic and nutritional analyses have revealed that:

    1. The archaeal pathway requires the functions of genes Vng1370G, Vng1371Gm, and Vng1369G, which encode orthologs of the bacterial cobalamin ABC transporter permease (btuC), ATPase (btuD), and substrate-binding protein (btuF) components .

    2. Mutations in cbiP (encoding adenosylcobyric acid synthase) render the organism auxotrophic for adenosylcobyric acid but still able to salvage cobinamide, indicating a distinct salvaging pathway .

    3. Mutations in cbiB (encoding adenosylcobinamide-phosphate synthase) result in auxotrophy for adenosylcobinamide-GDP and inability to salvage cobinamide .

    These findings suggest that the entry point for cobinamide salvaging in H. salinarum is adenosylcobyric acid, with an amidohydrolase potentially cleaving the aminopropanol moiety of adenosylcobinamide to yield adenosylcobyric acid .

  • What expression systems are most effective for producing recombinant Halobacterium salinarum cobS?

    For recombinant production of H. salinarum cobS, Escherichia coli expression systems have proven most effective, particularly when using His-tagged constructs. Based on available research data, the following methodological approach is recommended:

    1. Gene amplification: The cobS gene (1-199 aa) should be amplified by PCR from H. salinarum genomic DNA .

    2. Vector selection: pGEX-KG or similar vectors with N-terminal His-tags have demonstrated successful expression .

    3. Expression host: E. coli strain BL21(DE3) has been successfully used for expression of halophilic proteins from H. salinarum .

    4. Protein purification: Immobilized metal affinity chromatography (IMAC) is effective for purification of His-tagged cobS protein .

    5. Storage conditions: The purified protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, addition of 5-50% glycerol and storage at -20°C/-80°C is recommended .

    It's important to note that H. salinarum genes often express poorly in Salmonella enterica, whereas genes from archaeal methanogens express well in this system .

Advanced Research Questions

  • How does salt concentration affect the structure and function of recombinant Halobacterium salinarum cobS in experimental settings?

    Salt concentration critically impacts both the structure and function of recombinant H. salinarum cobS due to its halophilic nature. Research demonstrates that:

    1. Protein stability: Like other halophilic proteins, cobS requires high salt concentrations to maintain proper folding. In vitro studies show that halophilic proteins subjected to below approximately 15% salt denature through misfolding, aggregation, and/or precipitation .

    2. Enzyme activity: The optimal salt concentration for halophilic enzymes from H. salinarum varies, but many show peak activity at specific salt concentrations. For example, the halophilic aldehyde dehydrogenase (ALDH) from H. salinarum exhibits maximum activity at 1M NaCl .

    3. Experimental considerations: When working with recombinant cobS, researchers should consider the following salt conditions:

      • Expression conditions: Standard E. coli expression conditions are suitable for protein production, but proper folding may require salt adjustment .

      • Purification buffers: Include at least 1-2M NaCl in purification buffers to maintain protein stability .

      • Activity assays: Test enzyme activity across a range of salt concentrations (0.5-4.3M NaCl) to determine optimal conditions for your specific experimental setup .

    4. Salt adaptation mechanisms: H. salinarum proteome analysis across different salt concentrations (3.5, 4.3, and 6.0M NaCl) revealed significant down-regulation of 14 proteins at non-optimal salt concentrations, highlighting the organism's molecular adaptation mechanisms .

  • What are the critical factors in designing experiments to assess cobS functionality in cobalamin biosynthesis?

    When designing experiments to assess cobS functionality in cobalamin biosynthesis, several critical factors must be considered:

    1. Genetic manipulation approaches:

      • In-frame deletion mutants: Create Δcobs mutants using established genetic tools for H. salinarum. Complementation with wild-type cobS can confirm phenotypes are specifically due to cobS deletion .

      • Use positive and negative controls: Include wild-type strains and mutants in related pathway genes (e.g., cbiB, cbiP) to contextualize results .

    2. Growth media composition:

      • Defined media: Use chemically defined media lacking corrinoid precursors to test de novo synthesis capacity .

      • Supplementation experiments: Test growth with various cobalamin precursors (e.g., cobinamide, adenosylcobyric acid) to assess salvaging pathways .

    3. Analytical methods:

      • Cobalamin detection: Use sensitive bioassays to detect cobalamin molecules in cell extracts .

      • Growth curve analysis: Monitor growth rates under various conditions to assess cobalamin-dependent phenotypes .

    4. Environmental parameters:

      • Salt concentration: Test functionality at various salt concentrations (optimally between 3.5-4.5M NaCl) relevant to H. salinarum's natural environment .

      • Temperature and pH: Maintain conditions appropriate for halophilic archaea (typically 37-45°C, pH 7.0-8.0) .

    5. Functional validation:

      • Heterologous complementation: Test if H. salinarum cobS can complement cobS mutants in other organisms (considering the differences between archaeal and bacterial pathways) .

      • In vitro enzyme assays: Establish assays to measure adenosylcobinamide-GDP ribazoletransferase activity directly .

  • How can researchers resolve discrepancies between in vivo and in vitro experimental results when studying recombinant Halobacterium salinarum cobS?

    Resolving discrepancies between in vivo and in vitro results when studying recombinant H. salinarum cobS requires systematic troubleshooting:

    1. Protein folding and stability considerations:

      • In vivo, H. salinarum maintains high intracellular K+ concentrations to counterbalance external Na+ levels. In vitro experiments should mimic these conditions .

      • Test protein stability using circular dichroism or differential scanning calorimetry across various ionic conditions to determine optimal buffers for in vitro work .

    2. Cofactor requirements:

      • Identify potential cofactors required for cobS function that may be present in vivo but absent in vitro.

      • Supplement in vitro reactions with cellular extracts to identify missing components .

    3. Protein-protein interactions:

      • Investigate if cobS functions within a protein complex in vivo. Research on related cobalamin biosynthesis genes suggests such interactions may occur .

      • Use pull-down assays or crosslinking studies to identify interaction partners .

    4. Post-translational modifications:

      • Examine if cobS undergoes post-translational modifications in vivo that affect activity.

      • Use mass spectrometry to characterize modifications on native versus recombinant protein .

    5. Methodological approach to resolve discrepancies:

      • Compare growth phenotypes of wild-type and ΔcobS mutants under various conditions .

      • Complement ΔcobS strains with recombinant cobS variants to identify critical functional domains .

      • Use transcriptomics and proteomics to identify compensatory mechanisms activated in response to cobS dysfunction .

  • What are the implications of cobS function in Halobacterium salinarum for the ecological role of cobalamin production in hypersaline environments?

    The cobalamin biosynthesis function of cobS in H. salinarum has significant implications for hypersaline ecology:

    1. Community metabolic interdependencies:

      • Cobalamin-producing organisms like H. salinarum may function as "helpers" in the microbial community, providing essential vitamins to "beneficiaries" that lack biosynthetic capability, creating a Black Queen function in hypersaline environments .

      • Metagenomic analyses of hypersaline environments have detected B12-dependent enzymes (e.g., methylmalonyl-CoA mutases, MTR 5-methyltetrahydrofolate-homocysteine methyltransferases, ribonucleoside-diphosphate reductases) in organisms that lack complete cobalamin biosynthesis pathways, suggesting metabolic dependencies .

    2. Ecological significance:

      • H. salinarum and related Halonotius species have been found to be abundant in various hypersaline environments, suggesting their importance as cobalamin providers in these ecosystems .

      • The ability to produce cobalamin despite the high metabolic cost indicates strong selective pressure to maintain this function .

    3. Environmental adaptation:

      • The unique archaeal cobalamin biosynthesis pathway may represent an adaptation to the extreme conditions of hypersaline environments .

      • H. salinarum's ability to survive salt fluctuations (from 0.5M to 4.3M NaCl) suggests mechanisms for maintaining essential metabolic functions, including cobalamin production, during environmental stress .

    4. Biotechnological implications:

      • Understanding cobS function in hypersaline environments could inform the development of engineered microbial communities for bioremediation of polluted hypersaline environments .

      • The extreme stability of H. salinarum enzymes may be valuable for industrial applications in hypersaline conditions .

  • How does the genomic context of the cobS gene influence its expression and regulation in Halobacterium salinarum?

    The genomic context of the cobS gene significantly influences its expression and regulation in H. salinarum:

    1. Genomic organization:

      • In H. salinarum, cobS (identified as Vng1580H) is part of a cobalamin biosynthesis gene cluster that includes other related genes .

      • This organization suggests coordinated regulation of the entire cobalamin biosynthesis pathway .

    2. Transcriptional regulation:

      • Genome-wide studies have revealed that 54% of all protein-coding genes in H. salinarum are targeted by multiple mechanisms for post-transcriptional processing and regulation .

      • The cobS gene is likely subject to complex regulatory control involving SmAP1 binding, antisense RNAs, and RNase-mediated regulation .

    3. Environmental response elements:

      • Analysis of H. salinarum's genome suggests that cobalamin-related genes respond to environmental cues including salt concentration, oxygen levels, and nutrient availability .

      • Transcriptomic analysis across growth phases shows differential expression patterns for cobalamin biosynthesis genes, including cobS .

    4. Experimental approaches to study regulation:

      • Promoter analysis: Identify regulatory elements upstream of cobS using bioinformatic approaches and experimental validation .

      • Reporter gene assays: Use fluorescent or enzymatic reporters fused to the cobS promoter to monitor expression under various conditions .

      • Chromatin immunoprecipitation (ChIP): Identify transcription factors that bind to the cobS promoter region .

    5. Post-transcriptional regulation:

      • H. salinarum employs extensive post-transcriptional regulation mechanisms, with evidence suggesting that 7% of all protein-coding genes show discordance between mRNA and protein levels .

      • Comparison of transcriptomic (RNA-Seq) and proteomic (SWATH-MS) data can reveal if cobS is subject to such regulation .

Methodological Approaches

  • What are the optimal protocols for expression and purification of recombinant Halobacterium salinarum cobS for structural studies?

    Based on the available research data, the following optimized protocol is recommended for expression and purification of recombinant H. salinarum cobS for structural studies:

    Expression Protocol:

    1. Construct preparation:

      • Clone the full-length cobS gene (1-199 aa) into an expression vector with an N-terminal His-tag .

      • Transform the construct into E. coli BL21(DE3) cells .

    2. Culture conditions:

      • Grow transformed cells in LB medium supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8 .

      • Induce protein expression with 0.5-1.0 mM IPTG and continue growth at 18-20°C overnight to minimize inclusion body formation .

    Purification Protocol:

    1. Cell lysis:

      • Harvest cells by centrifugation at 4,000 × g for 20 minutes at 4°C.

      • Resuspend cell pellet in lysis buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 1-2 M KCl, 10 mM imidazole, and protease inhibitors .

      • Lyse cells by sonication or French press.

    2. Protein purification:

      • Clarify lysate by centrifugation at 16,000 × g for 30 minutes at 4°C.

      • Load supernatant onto a Ni-NTA column pre-equilibrated with lysis buffer.

      • Wash with buffer containing 20-30 mM imidazole.

      • Elute with buffer containing 250-300 mM imidazole .

    3. Buffer exchange and concentration:

      • Dialyze purified protein against storage buffer (50 mM Tris-HCl pH 8.0, 1-2 M KCl, 150 mM NaCl).

      • Concentrate using centrifugal filters (10 kDa cut-off) .

    4. Quality assessment:

      • Verify purity by SDS-PAGE (>90% purity recommended for structural studies) .

      • Assess protein homogeneity by dynamic light scattering or size-exclusion chromatography.

    5. Storage:

      • For short-term storage, keep at 4°C in storage buffer.

      • For long-term storage, add glycerol to 50% final concentration and store at -20°C or -80°C in small aliquots to avoid freeze-thaw cycles .

  • How can researchers design comparative studies between bacterial and archaeal cobalamin synthases to identify evolutionary adaptations?

    To design effective comparative studies between bacterial and archaeal cobalamin synthases, researchers should consider the following methodological approach:

    1. Sequence and structure analysis:

      • Perform multiple sequence alignments of cobS proteins from diverse bacteria and archaea to identify conserved and divergent regions .

      • Use homology modeling and structural prediction to compare the three-dimensional structures of bacterial and archaeal cobS proteins .

      • Identify potential salt-adaptation signatures in halophilic archaeal cobS sequences (e.g., increased acidic residues, reduced hydrophobic residues) .

    2. Functional complementation experiments:

      • Clone cobS genes from representative bacteria and archaea (including H. salinarum) into expression vectors.

      • Test the ability of each cobS ortholog to complement cobS-deficient strains of both bacteria (e.g., Salmonella enterica) and archaea (e.g., H. salinarum) .

      • Compare complementation efficiency under various environmental conditions (salt concentration, temperature, pH) .

    3. Enzymatic characterization:

      • Purify recombinant cobS proteins from bacterial and archaeal sources.

      • Compare kinetic parameters (Km, Vmax, kcat) across different salt concentrations and temperatures .

      • Investigate substrate specificity differences that might indicate evolutionary adaptations .

    4. Structural biology approaches:

      • Determine crystal structures or use cryo-electron microscopy to compare bacterial and archaeal cobS proteins at atomic resolution.

      • Identify structural features unique to halophilic archaeal enzymes .

    5. Genomic context analysis:

      • Compare the organization of cobalamin biosynthesis gene clusters across bacteria and archaea.

      • Identify syntenic relationships and gene rearrangements that might indicate evolutionary events .

    6. Phylogenetic analysis:

      • Construct phylogenetic trees of cobS sequences to trace the evolutionary history of this enzyme.

      • Correlate evolutionary relationships with environmental adaptations and taxonomic classifications .

  • What advanced analytical techniques can be used to study the interaction between Halobacterium salinarum cobS and other components of the cobalamin biosynthesis pathway?

    Several advanced analytical techniques can be employed to study interactions between H. salinarum cobS and other components of the cobalamin biosynthesis pathway:

    1. Protein-protein interaction studies:

      • Co-immunoprecipitation (Co-IP): Use antibodies against cobS or epitope-tagged cobS to pull down interacting proteins, followed by mass spectrometry identification .

      • Bacterial/archaeal two-hybrid systems: Adapt two-hybrid systems for use in high-salt conditions to detect interactions in vivo .

      • Biolayer interferometry (BLI) or surface plasmon resonance (SPR): Measure real-time binding kinetics between cobS and potential interaction partners under varying salt concentrations .

    2. Structural studies of protein complexes:

      • Cryo-electron microscopy: Visualize large cobalamin biosynthetic complexes that may include cobS .

      • Cross-linking mass spectrometry (XL-MS): Use chemical cross-linkers to capture transient interactions, followed by mass spectrometry to identify cross-linked peptides .

      • Small-angle X-ray scattering (SAXS): Obtain low-resolution structural information about cobS complexes in solution .

    3. Metabolic pathway analysis:

      • Metabolomics: Use liquid chromatography-mass spectrometry (LC-MS) to track cobalamin intermediates in wild-type and ΔcobS strains .

      • Isotope labeling: Use 13C or 15N-labeled precursors to trace the flow of metabolites through the pathway .

      • Enzyme assays: Develop coupled assays to measure the activity of sequential enzymes in the pathway .

    4. Systems biology approaches:

      • Transcriptomics: Compare gene expression profiles between wild-type and cobS mutant strains to identify regulatory relationships .

      • Proteomics: Use quantitative proteomics to measure changes in protein abundance and post-translational modifications .

      • Network analysis: Construct protein-protein interaction networks and metabolic networks to contextualize cobS function .

    5. In situ localization:

      • Fluorescence microscopy: Use fluorescently tagged cobS to determine its subcellular localization and potential co-localization with other pathway components .

      • Immunogold electron microscopy: Achieve higher-resolution localization of cobS within archaeal cells .

Data Integration and Analysis

  • How can researchers integrate diverse experimental data to build comprehensive models of cobS function in Halobacterium salinarum?

    Integrating diverse experimental data to build comprehensive models of cobS function requires a systematic approach:

    1. Multi-omics data integration:

      • Combine genomics, transcriptomics, proteomics, and metabolomics data to create a holistic view of cobS function .

      • Use statistical methods like correlation analysis and principal component analysis to identify relationships between different data types .

      • Example approach: The multi-omics atlas for H. salinarum NRC-1 (https://halodata.systemsbiology.net) demonstrates successful integration of transcriptome-wide locations of transcript processing sites, SmAP1 binding, genome-wide locations of antisense RNAs, and differential expression data .

    2. Computational modeling approaches:

      • Construct metabolic flux models of the cobalamin biosynthesis pathway incorporating enzymatic parameters of cobS .

      • Use protein structure prediction and molecular dynamics simulations to model cobS function under various salt conditions .

      • Integrate models with experimental data through iterative refinement .

    3. Visualization tools:

      • Develop interactive visualizations that allow exploration of cobS in its genomic, metabolic, and protein interaction contexts .

      • Use pathway visualization tools to highlight cobS's position within the cobalamin biosynthesis network .

    4. Experimental validation cycle:

      • Generate hypotheses from integrated data models.

      • Design targeted experiments to test specific aspects of the model.

      • Incorporate new experimental results to refine the model .

    5. Comparison with related organisms:

      • Extend models to include comparative data from other halophilic archaea like Halonotius species .

      • Identify conserved and divergent features to contextualize cobS function evolutionarily .

    6. Example integration framework:

      • Start with genomic context and sequence analysis of cobS.

      • Add structural information from homology modeling or crystallography.

      • Incorporate protein-protein interaction data to identify functional complexes.

      • Add metabolic data on substrate utilization and product formation.

      • Integrate transcriptomic and proteomic data to understand regulation.

      • Use genetic perturbation data (e.g., from cobS mutants) to validate model predictions .

    By implementing this integrated approach, researchers can develop comprehensive models that capture the multifaceted role of cobS in H. salinarum metabolism and its ecological importance in hypersaline environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.