Recombinant Halobacterium salinarum Halobacterial transducer protein 5 (htr7)

Shipped with Ice Packs
In Stock

Description

Introduction to Halobacterium salinarum and Its Transducer Proteins

Halobacterium salinarum is a halophilic archaeon that thrives in environments with extremely high salt concentrations, such as salt lakes and solar salterns. This microorganism has evolved unique mechanisms to survive and adapt to these harsh conditions, including a complex system of signal transduction mediated by transducer proteins. Among these proteins, the Halobacterial transducer protein 5 (Htr7) plays a crucial role in chemotaxis and sensory signal transduction.

Overview of Halobacterial Transducer Proteins

Halobacterial transducer proteins are part of a family of soluble and membrane-bound transducers that mediate signal transduction in Halobacterium salinarum. These proteins are involved in chemotaxis, allowing the bacteria to move towards attractants and away from repellents. The family includes 13 known transducers, with each playing specific roles in sensing different chemical stimuli.

For example, HtrXI is involved in taxis towards aspartate and glutamate, while also adapting chemotactic responses to histidine . The complexity of these transducer proteins and their interactions is crucial for the survival of Halobacterium salinarum in its environment.

Recombinant Protein Technology in Archaea

Recombinant protein technology involves expressing genes from one organism in another host organism. In the context of archaea like Halobacterium salinarum, this technology can be used to produce proteins with unique properties, such as halotolerance or thermostability.

While specific details on recombinant Htr7 are not available, the production of recombinant proteins from haloarchaea often involves using hosts like E. coli for expression. For instance, recombinant α-amylase from haloarchaea has been successfully expressed in E. coli, demonstrating the potential for producing functional enzymes from these extremophiles .

Potential Applications and Research Directions

The study of recombinant proteins from Halobacterium salinarum, including transducer proteins like Htr7, could lead to insights into novel biotechnological applications. These proteins might offer unique properties useful in biotechnology, such as enhanced stability under extreme conditions.

Table: Potential Biotechnological Applications of Haloarchaeal Proteins

Protein TypePotential ApplicationsUnique Properties
α-amylaseIndustrial enzyme productionHalotolerance, thermostability
Transducer proteinsBiotechnological sensors, signaling pathwaysAdaptability to extreme conditions
GlycoproteinsVaccine development, diagnosticsNovel glycosylation patterns

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If a specific tag is required, please inform us, and we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-545
Protein Length
full length protein
Target Names
Target Protein Sequence
MSGAAVFVDAVVAPLGDAVGAIGFGAAAALGYRNYRDTDAEAAFWMAFTFASLLGVTWTV SLMLEKAGVATQIFNLATGPLMATTVAVFAIGGTATLAIVEDMEALVEERAQRRQEAEEE RAEAERAREKAEQKQAEAERQTAEAESAKQDARERSAEIEQLAADLESQATEVGATLEAA SDGDLTARVDATTDNAEIAEVATVVNDMLTTMERTIDEIQGFSTNVTTASREATAGAKEI QDASQTVSESVQEIAAGTDDQREQLESVAEEMDSYSATVEEVAATAQSVADTAADTTDVA TAGKQTAEDAIDAIDAVQETMQTTVANVDALEDLTTEIDDIAELISDIAEQTNMLALNAN IEAARAGSGGGSNGDGFAVVADEVKELATESQRSAKDIAELIEEVQSQTATTVEEIRVAE QRVNDGAAAVEETVDAFGAVTENIQETTDGVQEISQAMDEQAQRSERVVSSVDDIATISQ ATADRAENVSAASEEQTASITEVTSSLQSLAAQADTLEDRLNEFRTEATGTAHGEATDAP AGQSD
Uniprot No.

Q&A

What is Halobacterium salinarum halobacterial transducer protein 5 (htr7)?

Halobacterial transducer protein 5 (htr7) belongs to a family of transducer proteins in Halobacterium salinarum that are homologous to bacterial methyl-accepting chemotaxis proteins (MCPs). These proteins, collectively known as halobacterial transducer proteins (Htps), contain highly conserved signaling domains at their C-terminus that interact with histidine kinases and undergo adaptive methylation. The N-terminal regions of these proteins define their specific functions through modular architecture, which may include domains for ligand binding and membrane anchoring via transmembrane helices . The full-length htr7 protein consists of 545 amino acids and can be produced recombinantly with tags such as His-tag for purification and detection purposes .

How does htr7 compare structurally to other halobacterial transducer proteins?

Structurally, htr7 shares the modular architecture characteristic of halobacterial transducer proteins, with conserved signaling domains that exhibit 31-43% identity when compared with other Htps or their bacterial analogs. Unlike some transducers that contain multiple (0-3) transmembrane helices, the hydropathy analysis of certain Htps suggests cytoplasmic localization similar to HtpIII, which lacks transmembrane domains and functions as a soluble protein . The amino acid sequence of htr7 (MSGAAVFVDAVVAPLGDAVGAIGFGAAAALGYRNYRDTDAEAAFWMAFTFASLLGVTWTV SLMLEKAGVATQIFNLATGPLMATTVAVFAIGGTATLAIVEDMEALVEERAQRRQEAEEE RAEAERAREKAEQKQAEAERQTAEAESAKQDARERSAEIEQLAADLESQATEVGATLEAA SDGDLTARVDATTDNAEIAEVATVVNDMLTTMERTIDEIQGFSTNVTTASREATAGAKEI QDASQTVSESVQEIAAGTDDQREQLESVAEEMDSYSATVEEVAATAQSVADTAADTTDVA TAGKQTAEDAIDAIDAVQETMQTTVANVDALED) shows regions consistent with signaling functionality and possible membrane association .

What is the functional role of htr7 in Halobacterium salinarum?

While the specific function of htr7 has not been explicitly detailed in the provided search results, we can infer its role based on related halobacterial transducers. These proteins are typically involved in chemo- or phototactic signal transduction, allowing the organism to respond to environmental stimuli. For example, HtrI mediates phototaxis in response to green and UV light stimuli by forming a complex with sensory rhodopsin I (SRI), while HtrXI is involved in taxis toward amino acids like glutamate, aspartate, and histidine .

Similarly, the Car transducer (cytoplasmic arginine transducer) mediates the arginine chemotactic response. These transducer proteins activate the histidine kinase CheA, initiating a phosphorylation cascade that ultimately controls flagellar rotation and cell movement . Given its structural similarities to other Htps, htr7 likely functions in a comparable signaling pathway, potentially responding to specific environmental cues that remain to be fully characterized through targeted deletion studies and complementation experiments.

What expression systems are most effective for producing recombinant htr7?

Based on the available data, E. coli appears to be an effective expression system for producing recombinant halobacterial transducer protein 5. Specifically, recombinant full-length Halobacterium salinarum htr7 protein (amino acids 1-545) has been successfully expressed in E. coli with an N-terminal His-tag . When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli if using the native halobacterial sequence

  • Inclusion of appropriate purification tags (His-tag appears effective)

  • Selection of induction conditions that balance protein yield with proper folding

  • Consideration of solubility enhancers if aggregation occurs

The final product is typically provided as a lyophilized powder, suggesting this formulation maintains stability for research applications . Alternative expression systems such as yeast or insect cells might be considered for experiments requiring different post-translational modifications, though no specific data on these systems was provided in the search results.

What methodological approaches are most effective for studying htr7 function?

Several methodological approaches have proven effective for studying halobacterial transducer proteins like htr7:

  • Gene deletion studies: Targeted deletion of transducer genes (as done with htpIII, IV, V, and VI) allows researchers to screen for phenotypic defects, establishing direct links between specific chemoattractants and their transducers .

  • Complementation assays: Reintroducing the intact gene into deletion mutants to restore wild-type behavior confirms gene-function relationships, as attempted with htpV .

  • Southern blot analysis: Using probes to the signaling domains of htps helps identify and characterize genomic modifications and unexpected mutations that may occur during genetic manipulations .

  • Capillary assays: These assays effectively measure chemotactic responses to various stimuli, helping identify deficiencies in mutant strains .

  • DNA sequence analysis: Comparing newly identified transducer genes with known sequences helps establish evolutionary relationships and predict functional domains .

  • Hydropathy analysis: This approach helps determine whether a transducer protein is likely to be membrane-associated or cytoplasmic, informing experimental design .

When specifically studying htr7, researchers should consider combining these approaches with protein-protein interaction studies to identify binding partners and signaling pathway components.

How can researchers distinguish between native and recombinant htr7 in experimental settings?

Several techniques can help researchers distinguish between native and recombinant htr7:

  • Western blotting with tag-specific antibodies: When using His-tagged recombinant htr7, anti-His antibodies will specifically detect the recombinant protein but not the native form .

  • Size differentiation: The addition of tags may cause slight molecular weight differences that can be detected via SDS-PAGE or Western blotting.

  • Mass spectrometry: This technique can identify tag-specific peptides in recombinant proteins.

  • Immunoprecipitation: Using tag-specific antibodies for pulldown experiments enriches only the recombinant protein.

  • Functional assays: Comparing activities of purified recombinant protein against native cellular extracts may reveal functional differences.

It's worth noting that Western blotting has been successfully used to demonstrate that certain halobacterial transducers like HtpIII are soluble, suggesting this technique is viable for studying htr7 as well .

How does the modular architecture of htr7 contribute to its signaling capabilities?

The modular architecture of halobacterial transducer proteins, including htr7, is critical to their signaling function. These proteins contain:

  • C-terminal signaling domain: Highly conserved region (31-43% identity between different Htps) that interacts with the histidine kinase CheA, transferring the signal from the sensory domain .

  • Adaptive methylation region: This region undergoes methylation/demethylation to adapt to prolonged stimulation, allowing the cell to respond to concentration changes rather than absolute levels of stimuli .

  • N-terminal sensory domain: Defines the specific function of the transducer, either through direct ligand binding or interaction with sensory proteins like rhodopsins .

  • Transmembrane helices (when present): Anchor the protein in the membrane and may participate in transmitting conformational changes .

In the case of cytoplasmic transducers that lack transmembrane domains (like Car and potentially htr7), the protein likely responds to intracellular signals rather than external stimuli. The signaling mechanism involves conformational changes that propagate from the sensory domain to the signaling domain, activating the histidine kinase and initiating a phosphorylation cascade that ultimately controls cell behavior .

What are the challenges in identifying specific ligands or stimuli for htr7?

Identifying specific ligands or stimuli for halobacterial transducers like htr7 presents several challenges:

  • Functional redundancy: Multiple transducers may respond to similar stimuli, complicating the interpretation of deletion studies. For example, HtrII functions as both a phototactic transducer and a chemotactic transducer for serine .

  • Spontaneous mutations: As observed with ΔhtpV-3, spontaneous mutations potentially caused by transposition of halobacterial insertion sequences can complicate genetic analysis by introducing unintended phenotypic changes .

  • Indirect sensing mechanisms: Some transducers don't bind ligands directly but instead form complexes with other sensory proteins, as seen with HtrI and sensory rhodopsin I (SRI) .

  • Cytoplasmic vs. membrane-associated function: Determining whether a transducer responds to intracellular or extracellular signals affects experimental design. Cytoplasmic transducers like Car respond to intracellular metabolites, requiring different assay conditions than membrane-associated transducers .

  • Multiple stimuli integration: Some transducers may integrate responses to multiple stimuli, requiring comprehensive testing across different conditions.

Researchers should employ complementary approaches such as systematic screening with diverse stimuli using capillary assays, binding studies with purified protein, and comprehensive genetic analysis to overcome these challenges.

What experimental strategies can help elucidate htr7's role in halobacterial signaling pathways?

To elucidate htr7's role in halobacterial signaling pathways, researchers could employ the following strategic approach:

  • Targeted gene deletion: Create a clean deletion of the htr7 gene and systematically screen for defects in chemotactic or phototactic responses to various stimuli using capillary assays or other behavioral tests .

  • Complementation studies: Reintroduce the intact htr7 gene into deletion mutants to confirm that any observed phenotypic defects are specifically due to the absence of htr7 .

  • Domain swapping experiments: Create chimeric proteins by swapping domains between htr7 and functionally characterized transducers to identify which regions determine stimulus specificity.

  • Protein-protein interaction studies: Use pull-down assays, co-immunoprecipitation, or yeast two-hybrid approaches to identify proteins that interact with htr7, potentially revealing components of its signaling pathway .

  • Phosphorylation assays: Measure the effect of potential stimuli on CheA phosphorylation in systems containing purified htr7 to directly assess signaling activity.

  • Localization studies: Determine whether htr7 is cytoplasmic or membrane-associated using cellular fractionation and Western blotting, informing hypotheses about its potential stimuli .

  • Comparative genomics: Analyze the presence and conservation of htr7 across different archaea to gain insights into its evolutionary history and potential functional importance.

This multifaceted approach would provide complementary lines of evidence to establish htr7's role in halobacterial signaling.

How should researchers interpret phenotypic data from htr7 deletion mutants?

When interpreting phenotypic data from htr7 deletion mutants, researchers should consider several factors:

  • Confirmation of deletion: Always verify the deletion using multiple methods such as PCR and Southern blotting to ensure the targeted gene has been successfully removed without affecting adjacent regions .

  • Multiple independent clones: Analyze multiple independent deletion clones to distinguish between effects directly caused by the deletion and those resulting from spontaneous mutations or insertion sequences. As seen with htpV deletion, where two clones (ΔhtpV-1 and ΔhtpV-2) showed wild-type behavior while one (ΔhtpV-3) was deficient in arginine taxis, unexpected results may occur due to secondary mutations .

  • Complementation controls: Attempt to restore wild-type behavior by reintroducing the intact gene. Failure to restore function through complementation (as observed with ΔhtpV-3) may indicate additional genetic changes beyond the targeted deletion .

  • Comprehensive phenotypic screening: Test the deletion mutant against a wide range of potential stimuli, as transducers may respond to multiple signals. For example, HtrII functions in both phototaxis and serine chemotaxis .

  • Genomic analysis of mutants: When unexpected phenotypes emerge, perform genomic analysis (e.g., Southern blotting with probes to the signaling domains) to identify any additional mutations or rearrangements that might affect other transducer genes .

  • Functional redundancy consideration: Take into account potential functional redundancy among transducer proteins, which may mask phenotypic effects of single gene deletions.

What controls are essential when studying recombinant htr7 in different experimental contexts?

When studying recombinant htr7, several essential controls should be implemented:

  • Expression vector control: Include experiments with cells containing the empty expression vector to control for effects of the expression system itself.

  • Tag-only control: Express the tag (e.g., His-tag) alone or attached to an irrelevant protein to control for tag-specific effects in binding or functional studies .

  • Denatured protein control: Use heat-denatured recombinant htr7 to distinguish between specific biological activity and non-specific effects.

  • Wild-type vs. recombinant comparison: When possible, compare the behavior of the recombinant protein with that of the native protein in its normal cellular context.

  • Known transducer controls: Include well-characterized halobacterial transducers (e.g., HtrI, HtrII) as positive controls in signaling assays to validate experimental conditions .

  • Negative stimuli controls: When testing potential stimuli for htr7, include substances known not to elicit responses through this pathway.

  • Protein quality controls: Implement size exclusion chromatography or dynamic light scattering to confirm that the recombinant protein is properly folded and not aggregated.

These controls help ensure that observed effects are specifically attributable to the biological function of htr7 rather than experimental artifacts.

What potential applications exist for understanding htr7's role in cellular signaling mechanisms?

Understanding htr7's role in cellular signaling could advance several research areas:

  • Synthetic biology applications: Engineering custom sensing systems based on the modular architecture of halobacterial transducers could create novel biosensors for specific analytes.

  • Extremophile adaptation mechanisms: Studying how htr7 functions in extreme halophilic environments may reveal evolutionary adaptations applicable to protein engineering for harsh conditions.

  • Comparative signal transduction: Analysis of archaeal signaling through htr7 compared to bacterial and eukaryotic systems could reveal fundamental principles of cellular information processing across domains of life.

  • Drug discovery platforms: If htr7's ligand-binding domain can be characterized, it might serve as a template for designing screening platforms for novel compounds.

  • Biofilm formation understanding: Since chemotaxis plays roles in biofilm formation, insights from htr7 signaling might inform strategies to control microbial communities.

Understanding the fundamental mechanisms by which htr7 transduces signals could provide insights applicable beyond archaeal biology to broader questions in cell signaling and sensory biology.

How might advanced techniques enhance our understanding of htr7 structure-function relationships?

Several advanced techniques could significantly enhance our understanding of htr7:

  • Cryo-electron microscopy: Determining the three-dimensional structure of htr7 at different activation states would provide crucial insights into conformational changes during signaling.

  • Hydrogen-deuterium exchange mass spectrometry: This technique could map regions of htr7 that undergo conformational changes upon activation, helping identify functional domains.

  • Single-molecule FRET: By labeling different domains of htr7, researchers could observe real-time conformational changes in response to stimuli.

  • In vivo imaging with fluorescent proteins: Tagging htr7 with fluorescent proteins could reveal its localization and dynamics within living halobacterial cells.

  • Molecular dynamics simulations: Computational modeling of htr7's structure and potential conformational changes could generate testable hypotheses about signaling mechanisms.

  • Deep mutational scanning: Systematic analysis of thousands of htr7 variants could identify residues critical for function and reveal evolutionary constraints.

  • Protein-protein interaction networks: Techniques like BioID or proximity labeling could map the complete interaction network of htr7 in living cells.

These approaches would provide complementary insights into how htr7's structure enables its signaling function, potentially revealing new principles of signal transduction applicable across biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.