Recombinant Halobacterium salinarum Halorhodopsin (hop)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

HR is typically expressed in heterologous systems such as Escherichia coli or homologously in H. salinarum strains. Key production parameters include:

Expression Systems

  • Host: E. coli (with His-tag for purification) or H. salinarum (using the bop promoter) .

  • Yield: Up to 150,000 copies per cell in H. salinarum, comparable to bacteriorhodopsin .

  • Vector Design: Suicide vectors (e.g., pMR3/pMR4) integrate into the host genome for stable overexpression .

Purification

  • Membrane fragments are solubilized with detergents (e.g., Tween 20, n-octyl-β-d-glucoside) .

  • Crystallization achieved via vapor diffusion in ammonium sulfate and trehalose .

Chloride Transport Mechanism

  • Primary Binding Site (CBS I): A chloride ion near the protonated Schiff base is essential for pump activation. Deprotonation at high pH reduces CBS I occupancy without major structural changes .

  • Photocycle: Light-induced retinal isomerization (all-trans → 13-cis) triggers conformational shifts in helices E and F, enabling ion translocation .

Mutational Studies

  • R108 Mutants: Substitutions (e.g., R108I, R108H) reduce anion transport efficiency, highlighting the role of arginine in ion coordination .

  • Zinc Finger Motifs: Adjacent regulatory proteins (e.g., Brz) influence HR expression via zinc-dependent transcription control .

Applications in Optogenetics

HR’s light-gated chloride transport enables precise neuronal silencing:

  • Neural Inhibition: Hyperpolarizes neurons via Cl⁻ influx, suppressing action potentials .

  • Engineered Variants:

    • eNpHR3.0: Enhanced membrane localization using ER export and Kir2.1 trafficking signals .

    • Therapeutic Potential: Tested in Parkinson’s disease models to modulate subthalamic nucleus activity .

Recent Advances

  • Crystallography: New crystal forms (e.g., vesicle-fusion-derived lattices) enable analysis of photocycle intermediates with minimal helix restraints .

  • pH Sensitivity: Structural stability persists up to pH 10, facilitating studies of deprotonated states .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specification.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-274
Protein Length
Full Length of Mature Protein
Target Names
hop
Target Protein Sequence
AVRENALLSSSLWVNVALAGIAILVFVYMGRTIRPGRPRLIWGATLMIPLVSISSYLGLL SGLTVGMIEMPAGHALAGEMVRSQWGRYLTWALSTPMILLALGLLADVDLGSLFTVIAAD IGMCVTGLAAAMTTSALLFRWAFYAISCAFFVVVLSALVTDWAASASSAGTAEIFDTLRV LTVVLWLGYPIVWAVGVEGLALVQSVGVTSWAYSVLDVFAKYVFAFILLRWVANNERTVA VAGQTLGTMSSDD
Uniprot No.

Q&A

What is the structural composition of Halobacterium salinarum Halorhodopsin?

Halorhodopsin from Halobacterium salinarum (HsHR) is a seven-pass transmembrane protein (helices A-G) with an extracellular N-terminus . It contains a retinal chromophore covalently attached to a lysine in helix G via a Schiff base . The primary chloride-binding site (CBS I) is strategically located on the extracellular side next to the protonated Schiff base (PSB), while a second peripheral extracellular chloride-binding site (CBS II) is also present . HsHR belongs to the broader family of archaeal rhodopsins that function as membrane-embedded light-sensitive proteins facilitating ion transport across the cell membrane . The protein's structure reveals specific helical arrangements that enable conformational changes during the photocycle, with helices E and F potentially undergoing significant movements during the transport process .

How does the chloride transport mechanism of HsHR operate at the molecular level?

The chloride transport in HsHR is initiated by light activation, which triggers the all-trans to 13-cis isomerization of the retinal chromophore . This isomerization initiates a reversible photocycle consisting of several spectroscopically distinct intermediates . During this process, a chloride ion is transported from the extracellular medium into the cytoplasm . The transport mechanism involves the protonated Schiff base, which plays a crucial role in chloride binding at CBS I . The photocycle progression causes structural changes in the protein that facilitate the movement of the chloride ion through the membrane . In the ground state, a tightly bound chloride ion occupies CBS I close to the protonated Schiff base, and the light-triggered isomerization of retinal causes structural changes associated with the movement of this chloride ion .

What distinguishes Halobacterium salinarum Halorhodopsin from other halorhodopsins?

While both Halobacterium salinarum Halorhodopsin (HsHR) and Natronomonas pharaonis Halorhodopsin (NpHR) belong to the same family, they are only distantly related with approximately 60% sequence identity, with NpHR being 16 amino acids longer . These differences manifest in notable variations in ion specificity and photocycle kinetics, particularly in the late stages of the photocycle . In NpHR, ion release into the cytoplasm is associated with the O-intermediate, the decay of which is the rate-determining step within the NpHR photocycle . The molecular mechanisms facilitating ion transport in HsHR cannot be fully inferred from studies on NpHR due to these structural and functional differences . Additionally, HsHR shows a higher chloride ion affinity, making ion release from CBS I more difficult compared to other halorhodopsins .

What expression systems are most effective for recombinant production of HsHR?

The most effective expression system for recombinant production of HsHR is homologous expression in Halobacterium salinarum itself. According to research findings, HsHR has been successfully expressed in H. salinarum under the control of the strong bop promotor . This approach leverages the native cellular machinery and environment optimized for the production of halophilic proteins. The general protocol involves:

  • Transformation of H. salinarum with an expression vector containing the hop gene under the bop promotor

  • Growth of transformed cells in high-salt media

  • Isolation of HsHR-containing membrane patches through multiple centrifugation steps in water

  • Purification using detergent solubilization methods

This homologous expression system is particularly advantageous because it ensures proper folding, membrane insertion, and post-translational modifications of HsHR in its native environment. Attempts to express HsHR in heterologous systems often face challenges related to the halophilic nature of the protein and its requirement for high salt concentrations for stability.

What are the optimal crystallization conditions for structural studies of HsHR?

The crystallization of HsHR has been successfully achieved using the vesicle-fusion method, which is particularly effective for membrane proteins . The optimized protocol includes:

  • Preparation of HsHR membrane fragments in 50 mM Tris pH 8, 100 mM NaCl, and 0.5% Tween 20

  • Incubation at 25°C for 4 hours at 350 rev min^-1 or at 4°C overnight

  • Addition of n-Octyl-β-d-glucoside (OG) to a final concentration of 1-2%

  • Further incubation for 2 hours at 20°C and 350 rev min^-1

  • Concentration of solubilized HsHR using 50 kDa cutoff concentrators to 4-7 mg ml^-1

  • Setup of vapor-diffusion experiments

The optimal crystallization conditions identified include:

  • 2.2 M ammonium sulfate

  • 150 mM NaCl

  • 100 mM bicine pH 8

This new crystal form has significant advantages for structural studies as it features lateral contacts mediated by helices A and G, while helices E and F (which are suggested to perform large movements during the photocycle) are almost unrestrained by packing contacts . This arrangement might permit the displacement of these helices without disrupting the crystal lattice, making it an excellent system for the structural characterization of late HsHR photocycle intermediates by trapping or time-resolved experiments, especially at XFELs .

How can researchers effectively trap and characterize photocycle intermediates of HsHR?

Trapping and characterizing photocycle intermediates of HsHR can be achieved through both photochemical and chemical methods:

Photochemical trapping:

  • Light adaptation of crystals under an optical microscope

  • Flash-freezing the crystals at specific time points after illumination to capture different intermediates

  • Collection of diffraction data at cryogenic temperatures to maintain the trapped intermediate state

Chemical modification:

  • Modulation of pH to induce deprotonation of the Schiff base, which can generate intermediates resembling late stages of the photocycle

  • Soaking crystals at high pH to provoke deprotonation of the Schiff base and partial loss of chloride

  • Monitoring color changes (from purple to yellow) as an indicator of chloride depletion and intermediate formation

For comprehensive characterization, researchers should employ a combination of:

  • X-ray crystallography for structural details

  • Spectroscopic methods (UV-Vis, FTIR, Raman) to identify distinct intermediates

  • Time-resolved experiments, particularly at X-ray Free Electron Lasers (XFELs) for capturing transient states

What is the significance of His-95 in the chloride pumping mechanism of halorhodopsin?

His-95 plays a crucial role in the anion selectivity and pumping mechanism of halorhodopsin. Studies comparing amino acid sequences in the A-B and B-C interhelical loop segments across bacteriorhodopsins and halorhodopsins have provided insights into this mechanism . Research on halorhodopsin variants from different halobacterial strains has shown that His-95 is particularly important for pumping efficiency at low chloride concentrations .

The evidence supporting the importance of His-95 includes:

  • Functional studies of His-95 mutants demonstrated lower pumping activity in low chloride concentrations

  • Despite variations in surrounding amino acid sequences (EMPAGH substituted by QMPPGH in some strains), the charged residues including His-95 are conserved across halorhodopsins

  • The strategic position of His-95 likely influences the chloride binding affinity and/or the conformational changes required for ion translocation

These findings suggest that His-95 may be involved in chloride recognition, binding, or the structural rearrangements necessary for efficient ion pumping, particularly when chloride availability is limited. Researchers investigating the pumping mechanism should consider His-95 as a key residue for mutation studies and functional analysis.

How does pH affect the structure and function of HsHR, and what experimental approaches can probe these effects?

pH significantly affects the structure and function of HsHR, particularly through its impact on the protonation state of the Schiff base and consequently on chloride binding. Experimental evidence shows:

  • High pH conditions can induce deprotonation of the Protonated Schiff Base (PSB)

  • Deprotonation leads to reduced chloride affinity at CBS I, with occupancy decreasing from 1 to about 0.5 at high pH

  • The color of HsHR changes from purple to yellow upon chloride depletion at high pH

  • While partial chloride depletion doesn't cause immediate substantial conformational changes, prolonged soaking at high pH results in loss of crystal diffraction, suggesting eventual structural alterations

Experimental approaches to probe pH effects:

TechniquePurposeKey Parameters
UV-Vis SpectroscopyMonitor absorption changes between purple (λmax ~578 nm) and yellow formspH range 7-10, chloride concentration 0-1M
X-ray CrystallographyDetermine structural changes and chloride occupancyCrystal soaking at various pH values and times
FTIR SpectroscopyIdentify protonation state changes in key residuesDifferential spectra at various pH
Functional AssaysMeasure chloride pumping activityLight-induced pH changes in reconstituted systems
Molecular DynamicsSimulate protonation effects on structureDifferent protonation states of key residues

When designing experiments to study pH effects, researchers should consider:

  • The time-dependent nature of the structural changes

  • The interplay between pH, chloride concentration, and protein conformation

  • The potential for irreversible structural alterations at extreme pH values

How can I design experiments to investigate the role of helices E and F in the HsHR transport mechanism?

Helices E and F are believed to undergo significant movements during the photocycle of HsHR, playing a crucial role in the chloride transport mechanism . To investigate their function, consider the following experimental design approaches:

1. Site-Directed Mutagenesis Study:

  • Identify conserved residues in helices E and F using sequence alignment

  • Design point mutations that alter charge, hydrophobicity, or size properties

  • Express and purify mutant proteins

  • Assess functional impact through transport assays and spectroscopic analysis

2. Cross-linking Experiments:

  • Introduce cysteine pairs at strategic positions in helices E and F

  • Induce disulfide bond formation to restrict helix movement

  • Determine the effect on photocycle progression and chloride transport

  • Use variable-length cross-linkers to probe the extent of movement required

3. EPR Spectroscopy with Spin Labeling:

  • Introduce spin labels at key positions along helices E and F

  • Measure distance changes between labels during the photocycle

  • Correlate distance changes with functional states of the protein

4. Time-resolved Crystallographic Studies:

  • Utilize the new crystal form where helices E and F are minimally restrained

  • Design time-resolved experiments at X-ray Free Electron Lasers (XFELs)

  • Capture structural snapshots at different time points after photoactivation

  • Map the conformational trajectory of helices E and F during transport

5. Molecular Dynamics Simulations:

  • Build atomistic models of HsHR in a lipid bilayer

  • Simulate the effect of retinal isomerization on helix movements

  • Calculate energy barriers for conformational changes

  • Predict water and ion pathways associated with helix movement

By combining these complementary approaches, researchers can develop a comprehensive understanding of how helices E and F contribute to the chloride transport mechanism in HsHR. The unique crystal form with unrestricted E and F helices provides an unprecedented opportunity for structural characterization of these dynamic elements .

What is the recommended protocol for purification of recombinant HsHR?

The recommended protocol for purification of recombinant HsHR from Halobacterium salinarum involves several key steps optimized for this halophilic membrane protein:

  • Cell Lysis and Membrane Isolation:

    • Harvest cells expressing recombinant HsHR under the bop promotor

    • Lyse cells in hypotonic conditions to release cytoplasmic contents

    • Isolate HsHR-containing membrane patches through multiple centrifugation steps in water

    • Wash membrane fragments to remove peripheral proteins

  • Detergent Solubilization:

    • Resuspend membrane fragments in 50 mM Tris pH 8, 100 mM NaCl, and 0.5% Tween 20

    • Incubate at 25°C for 4 hours at 350 rev min^-1 or at 4°C overnight

    • Add n-Octyl-β-d-glucoside (OG) to a final concentration of 1-2%

    • Incubate for an additional 2 hours at 20°C and 350 rev min^-1

  • Protein Concentration:

    • Concentrate the solubilized HsHR using 50 kDa cutoff Vivaspin concentrators

    • Centrifuge at 4000g for 10-15 minutes to achieve a final concentration of 4-7 mg ml^-1

  • Quality Assessment:

    • Verify protein purity using SDS-PAGE

    • Confirm functionality through absorption spectroscopy (λmax ~578 nm)

    • Assess monodispersity using dynamic light scattering or size exclusion chromatography

This purification protocol leverages the native expression system to overcome challenges associated with the production of functional halophilic membrane proteins. The method minimizes the use of chromatographic steps, which can be challenging for membrane proteins, and instead relies on differential centrifugation and selective solubilization to achieve purification.

How do I design experiments to distinguish between the roles of primary and secondary chloride binding sites?

Distinguishing between the functional roles of the primary (CBS I) and secondary (CBS II) chloride binding sites in HsHR requires a multi-faceted experimental approach. The following experimental design strategies can be employed:

Site-directed Mutagenesis Strategy:

  • Identify residues specifically interacting with chloride at each binding site based on crystal structures

  • Create single and double mutants targeting residues at CBS I and CBS II

  • Express and purify mutant proteins

  • Characterize chloride binding properties and transport function

SiteKey Residues to TargetExpected Impact of Mutation
CBS IResidues near protonated Schiff baseAltered chloride affinity, disrupted photocycle
CBS IIPeripheral residues at extracellular surfaceModified initial chloride recognition, altered binding kinetics

Chloride Affinity Assays:

  • Titrate chloride concentration while monitoring spectral shifts

  • Determine binding constants (Kd) for wild-type and mutant proteins

  • Compare chloride affinity at different pH values to probe the relationship between Schiff base protonation and binding at each site

Time-resolved Spectroscopy:

  • Use laser flash photolysis to initiate the photocycle

  • Monitor spectral changes at wavelengths specific to different intermediates

  • Compare photocycle kinetics at varying chloride concentrations

  • Identify which photocycle steps are affected by mutations at each binding site

Structural Studies with Anion Substitution:

  • Replace chloride with bromide or iodide, which have higher electron density

  • Collect anomalous diffraction data to precisely locate binding sites

  • Compare occupancy at each site under various conditions

  • Correlate structural information with functional data

These experimental approaches will help researchers delineate the specific roles of CBS I and CBS II in the chloride transport mechanism of HsHR, providing insights into the sequential binding events and their coupling to the photocycle progression.

What are the key considerations for designing time-resolved crystallography experiments for HsHR?

Time-resolved crystallography experiments for HsHR require careful planning to capture the structural changes during the photocycle. The following key considerations should guide experimental design:

1. Crystal Form Selection:

  • Utilize the new crystal form of HsHR where helices E and F are minimally restrained by crystal contacts

  • This crystal form allows for potential conformational changes without disrupting the crystal lattice

  • Confirm diffraction quality and resolution limits before proceeding with time-resolved experiments

2. Photocycle Timing and Trigger Methods:

  • Determine the time constants of key photocycle intermediates through spectroscopic studies

  • Design time delays that match the kinetics of intermediates of interest

  • Consider both pump-probe methods for faster transitions and trap-quench approaches for slower steps

3. X-ray Source Selection:

  • For microsecond to millisecond intermediates: synchrotron sources with fast shutters

  • For nanosecond to microsecond intermediates: X-ray Free Electron Lasers (XFELs)

  • Match X-ray exposure time to the lifetime of the intermediate of interest

4. Sample Preparation Protocols:

  • Optimize crystal size to balance diffraction quality with light penetration

  • Ensure uniform illumination throughout the crystal volume

  • Consider microcrystals for serial crystallography approaches at XFELs

5. Data Collection Strategy:

  • For synchrotron studies: multiple short exposures on the same crystal with adequate recovery time

  • For XFEL studies: serial femtosecond crystallography with thousands of microcrystals

  • Implement appropriate controls to account for radiation damage

6. Analysis of Conformational Changes:

  • Focus on regions known to be dynamic (helices E and F)

  • Track the occupancy of the chloride binding sites during the photocycle

  • Use difference Fourier maps to identify subtle structural changes

  • Consider ensemble refinement for partially occupied intermediate states

By carefully addressing these considerations, researchers can design effective time-resolved crystallography experiments that capture the structural dynamics of HsHR during its photocycle, providing unprecedented insights into the mechanism of light-driven chloride transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.