Recombinant Halobacterium salinarum Lycopene beta-cyclase (crtY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crtY; OE_3983R; Lycopene beta-cyclase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-237
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Target Names
crtY
Target Protein Sequence
MTTSYLTFLAVAVGPPLVALGVVRAARWDGDRARAAGVGILLALALSYTTPWDNYLIATG VWWYGEGTVVGRLWQMPIEEYLFVITQTLLTGLWVQALPLRPTAGFSPTRRDAVLGALAG VLVGCGGAVLLTVDATFYIGAIIAWAAPVLALQWAVGWRYLWRRRRVFAAAVLVPTLFLS AADRYAIADGIWILAGQYTTGITVLGLPIEEGAFFFVTNVFVSQGLILYAWVLARWR
Uniprot No.

Target Background

Function
Catalyzes the cyclization of both ends of lycopene to form beta-carotene, a retinal precursor. This enzyme is essential for bacteriorhodopsin biogenesis, a light-driven proton pump with a covalently bound retinal cofactor.
Database Links

KEGG: hsl:OE_3983R

Protein Families
Lycopene beta-cyclase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of lycopene β-cyclase (crtY) in Halobacterium salinarum?

Lycopene β-cyclase (crtY) in H. salinarum catalyzes the conversion of lycopene to β-carotene, a critical step in the carotenoid metabolic pathway that ultimately leads to retinal production. This enzyme appears to be the sole means by which H. salinarum synthesizes β-carotene, as deletion studies have demonstrated that loss of crtY completely eliminates β-carotene production . The function of crtY is essential for bacteriorhodopsin (BR) biogenesis, as retinal derived from β-carotene serves as the covalently bound cofactor required for BR function. The metabolic pathway proceeds from lycopene → β-carotene → retinal, with crtY catalyzing the first conversion in this sequence .

How does the structure of H. salinarum crtY compare to lycopene cyclases in other organisms?

H. salinarum crtY shares structural similarities with lycopene cyclases found in both bacteria and fungi. Comparative sequence analysis reveals that H. salinarum crtY is predicted to be an integral membrane protein with a topology that provides insight into its evolutionary relationships . The protein contains multiple transmembrane segments that show homology to those found in bacterial heterodimeric cyclases (CrtYc and CrtYd) and fungal bifunctional lycopene cyclase-phytoene synthases .

The membrane topology model computed by TMHMM shows that H. salinarum crtY contains repeated domains similar to those found in bacterial and fungal cyclases. Specifically, the bacterial CrtYc and CrtYd proteins each have three transmembrane segments, and these same segments are evident in the repeated domains of H. salinarum crtY. Additionally, a fourth transmembrane helix links the repeated domains in the archaeal protein, similar to what is observed in fungal cyclases .

How can the function of recombinant H. salinarum crtY be experimentally confirmed?

The function of recombinant H. salinarum crtY can be confirmed through two complementary experimental approaches:

  • Deletion studies in native host: Creating H. salinarum strains with in-frame deletions of the crtY gene can confirm its function. In such deletion strains, bacteriorhodopsin, retinal, and β-carotene become undetectable, while lycopene accumulates to high levels (approximately 1.3 nmol/mg of total cell protein), indicating a block in the conversion of lycopene to β-carotene .

  • Heterologous expression in E. coli: Expression of H. salinarum crtY in lycopene-producing E. coli strains results in β-carotene production, providing direct evidence of its cyclase activity. This approach typically involves using an arabinose-inducible expression system, such as pBAD, compatible with the carotenoid production machinery already present in the engineered E. coli strain . The production of β-carotene can be monitored by HPLC analysis, with confirmation via UV-visible spectral features (absorbance maximum of 450 nm in isopropanol) and MALDI-TOF mass spectrometry (mass ion value of 536.42 for β-carotene) .

What phenotypic changes are observed in crtY deletion mutants of H. salinarum?

Deletion of the crtY gene in H. salinarum results in several notable phenotypic changes:

  • Color change: Colonies from crtY deletion strains appear pale red, distinct from the purple color of wild-type strains, suggesting reduced bacteriorhodopsin production .

  • Carotenoid profile alterations: HPLC analysis reveals that crtY deletion strains accumulate lycopene (approximately 1.3 nmol/mg of total cell protein) while β-carotene becomes undetectable .

  • Absence of bacteriorhodopsin and retinal: Spectroscopic and HPLC analyses show that bacteriorhodopsin and retinal are undetectable in crtY deletion strains, confirming that crtY function is essential for bacteriorhodopsin biogenesis .

  • Possible effects on other rhodopsins: The deletion likely affects the synthesis of other rhodopsins in H. salinarum, including halorhodopsin and sensory rhodopsins I and II, as these also require retinal as a cofactor .

What experimental approaches can be used to study the membrane topology of H. salinarum crtY?

The membrane topology of H. salinarum crtY can be investigated using several complementary approaches:

  • Computational prediction: Programs like TMHMM can be used to predict transmembrane segments based on the amino acid sequence . This provides an initial model that can guide experimental design.

  • Reporter fusion analysis: Systematic fusion of reporter proteins (such as alkaline phosphatase or green fluorescent protein) to different positions within the crtY sequence can help determine which domains are located on the cytoplasmic or extracellular side of the membrane.

  • Cysteine accessibility methods: Introduction of cysteine residues at specific positions in crtY, followed by labeling with membrane-permeable and impermeable sulfhydryl reagents, can help determine which regions are accessible from which side of the membrane.

  • Protease protection assays: In this approach, membrane vesicles are treated with proteases, and the pattern of proteolytic fragments is analyzed to determine which regions of the protein are protected by the membrane.

  • Epitope mapping: Introduction of epitope tags at different positions, followed by immunofluorescence microscopy with or without membrane permeabilization, can help determine the orientation of specific domains.

The topological model presented for H. salinarum crtY includes three transmembrane segments in each of the repeated domains, plus a fourth transmembrane helix linking these domains . This model provides a starting point for designing experiments to further refine our understanding of its membrane topology.

How can the heterologous expression of H. salinarum crtY in E. coli be optimized for maximum activity?

Optimizing heterologous expression of H. salinarum crtY in E. coli requires addressing several factors:

  • Expression vector selection: Using an inducible system, such as the arabinose-inducible pBAD vector, allows fine control over expression levels . The vector should be compatible with other plasmids carrying carotenoid biosynthetic genes.

  • Codon optimization: H. salinarum has different codon usage patterns than E. coli, so codon optimization of the crtY gene sequence may improve translation efficiency in E. coli.

  • Expression conditions optimization:

    • Induction timing: The optimal time point for inducer addition should be determined, typically during the exponential growth phase.

    • Inducer concentration: Titration of arabinose concentrations can identify the optimal level for crtY expression.

    • Temperature: Lower temperatures (16-30°C) during induction may improve proper protein folding and membrane insertion.

    • Duration of induction: As shown in the studies, β-carotene production increases with longer induction periods (from 0 to 6 hours) .

  • Membrane incorporation: As an integral membrane protein, proper insertion of crtY into the E. coli membrane is crucial. Addition of E. coli-derived signal sequences or fusion partners may facilitate this process.

  • Substrate availability: Ensuring adequate lycopene production in the host strain is essential. This typically involves using E. coli strains engineered to produce lycopene through the introduction of carotenoid biosynthetic genes from organisms like Erwinia uredovora .

  • Product analysis: HPLC analysis with appropriate standards can be used to monitor β-carotene production, with confirmation by UV-visible spectroscopy and mass spectrometry .

What methodological considerations are important for analyzing carotenoid profiles in crtY deletion mutants?

Analysis of carotenoid profiles in crtY deletion mutants requires careful attention to several methodological aspects:

  • Extraction procedures: Carotenoids are lipophilic compounds that require organic solvent extraction. Typical protocols involve:

    • Cell lysis under conditions that minimize oxidation (using antioxidants and working under nitrogen)

    • Extraction with acetone or methanol/chloroform mixtures

    • Multiple extraction rounds to ensure complete recovery

  • HPLC analysis parameters:

    • Column selection: C18 or C30 reverse-phase columns are commonly used for carotenoid separation

    • Mobile phase composition: Typically involves gradients of acetonitrile, methanol, and/or ethyl acetate

    • Detection wavelengths: Multiple wavelengths should be monitored (e.g., 450 nm for β-carotene, 470 nm for lycopene)

    • Internal standards: Addition of non-native carotenoids as internal standards can improve quantification accuracy

  • Quantification:

    • Standard curves should be prepared using authenticated standards of lycopene, β-carotene, and other relevant carotenoids

    • Results can be normalized to total cell protein (as in the reported accumulation of lycopene to approximately 1.3 nmol/mg of total cell protein)

  • Identification confirmation:

    • UV-visible spectroscopy: Each carotenoid has characteristic absorption maxima and spectral features

    • Mass spectrometry: MALDI-TOF or LC-MS can confirm the identity of carotenoid species based on their molecular masses and fragmentation patterns

  • Controls:

    • Wild-type strains should be analyzed in parallel

    • Complementation strains (crtY deletion mutants with reintroduced crtY gene) serve as important controls to confirm that observed changes are specifically due to crtY deletion

How can potential protein-protein interactions between crtY and other proteins involved in bacteriorhodopsin biogenesis be investigated?

Investigating protein-protein interactions between crtY and other proteins involved in bacteriorhodopsin biogenesis requires specialized approaches for membrane proteins:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against crtY or use epitope-tagged versions

    • Solubilize membranes using mild detergents that preserve protein-protein interactions

    • Precipitate crtY and identify co-precipitating proteins by mass spectrometry

  • Proximity-based labeling:

    • Fuse crtY to enzymes like BioID or APEX2 that can biotinylate or otherwise label proteins in close proximity

    • Identify labeled proteins by streptavidin pulldown and mass spectrometry

    • This approach is particularly valuable for transient interactions

  • Förster Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions of crtY and candidate interaction partners

    • Measure FRET signals in live cells to detect protein proximity

    • This approach can provide spatial and temporal information about interactions

  • Bacterial two-hybrid systems:

    • Modified for membrane proteins, these systems can detect interactions in a cellular context

    • CytoTrap or BACTH (Bacterial Adenylate Cyclase Two-Hybrid) systems are suitable for membrane protein interaction studies

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linkers can stabilize protein interactions

    • Cross-linked complexes can be isolated and analyzed by mass spectrometry

    • This approach can identify interaction interfaces

The positioning of crtY in proximity to blh (with overlapping open reading frames) suggests potential functional interactions between these proteins . The proposed model suggests that as integral membrane proteins, crtY, Brp, and Blh may directly interact within the membrane to influence carotenoid and retinal metabolism during bacteriorhodopsin biogenesis .

What techniques can be used to study the regulation of crtY expression during bacteriorhodopsin biogenesis?

The regulation of crtY expression during bacteriorhodopsin biogenesis can be studied using various molecular and biochemical techniques:

  • Transcriptional analysis:

    • Quantitative RT-PCR to measure crtY mRNA levels under different conditions

    • Northern blotting to determine transcript size and abundance

    • Promoter-reporter fusions (e.g., using lacZ or luciferase) to monitor promoter activity in vivo

  • Translational regulation analysis:

    • Western blotting with antibodies against crtY to measure protein levels

    • Translational fusions with reporter proteins to study translational efficiency

    • Ribosome profiling to analyze translation at the genome-wide level

  • Genetic approaches:

    • Mutational analysis of the promoter region to identify regulatory elements

    • Deletion or overexpression of potential transcription factors

    • Analysis of translational coupling with blh, as the genes appear to have overlapping open reading frames

  • Cellular conditions:

    • Studies under different growth conditions (e.g., light intensity, oxygen levels)

    • Analysis during different growth phases

    • Response to specific stresses known to affect bacteriorhodopsin production

  • Chromatin immunoprecipitation (ChIP):

    • Identification of transcription factors binding to the crtY promoter

    • Analysis of DNA-protein interactions during different stages of growth

The fact that crtY is located directly upstream of blh, with overlapping open reading frames, suggests that the genes might be translationally coupled in an operon . This arrangement could be important for coordinating the expression of these genes during bacteriorhodopsin biogenesis.

How should genetic complementation experiments be designed to confirm crtY function?

Genetic complementation experiments to confirm crtY function should be designed with the following considerations:

  • Vector selection:

    • Choose shuttle vectors that can replicate in both E. coli and H. salinarum

    • Consider vectors with different copy numbers to assess dosage effects

    • Include appropriate selectable markers for H. salinarum (typically mevinolin or novobiocin resistance)

  • Promoter considerations:

    • Use of native promoter to maintain physiological expression levels

    • Alternatively, use of inducible promoters (e.g., bacteriorhodopsin promoter) to control expression level and timing

  • Construction of complementation strains:

    • Introduction of wild-type crtY gene into the crtY deletion background

    • Creation of point mutants to assess the importance of specific residues

    • Inclusion of epitope tags if protein detection is needed

  • Controls:

    • Empty vector in deletion background (negative control)

    • Wild-type strain (positive control)

    • Complementation with known lycopene cyclases from other organisms as functional comparisons

  • Phenotypic analysis:

    • Colony color assessment (restoration of purple color)

    • Spectroscopic analysis for bacteriorhodopsin production

    • HPLC analysis for β-carotene and retinal production

    • Lycopene accumulation (should decrease upon complementation)

What are the key considerations for analyzing the evolutionary relationships between H. salinarum crtY and other lycopene cyclases?

Analyzing the evolutionary relationships between H. salinarum crtY and other lycopene cyclases requires careful consideration of several factors:

  • Sequence alignment methodologies:

    • Multiple sequence alignment algorithms optimized for membrane proteins

    • Consideration of structural features when aligning sequences

    • Manual curation of alignments to ensure proper alignment of functional domains

  • Phylogenetic analysis approaches:

    • Selection of appropriate evolutionary models (e.g., JTT, WAG for proteins)

    • Use of maximum likelihood, Bayesian, and distance-based methods for tree construction

    • Assessment of tree reliability through bootstrap analysis or posterior probabilities

  • Structural comparison:

    • Analysis of predicted membrane topology across different organisms

    • Identification of conserved amino acid residues in transmembrane domains

    • Comparison of domain organization between heterodimeric bacterial cyclases, bifunctional fungal enzymes, and the archaeal crtY

  • Functional domain analysis:

    • Identification of catalytic residues

    • Comparison of substrate specificity determinants

    • Analysis of potential fusion events in the evolutionary history

  • Genomic context analysis:

    • Examination of gene neighborhood across different organisms

    • Analysis of operon structures and potential co-evolution with other carotenoid biosynthetic genes

    • Consideration of the proximity of crtY to blh in H. salinarum and its implications

The existing data suggest that H. salinarum crtY provides a plausible evolutionary connection between heterodimeric lycopene cyclases in bacteria and bifunctional lycopene cyclase-phytoene synthases in fungi . This evolutionary relationship is supported by the protein's predicted membrane topology, which shows evidence of domain duplication or fusion events in its evolutionary history.

How can one distinguish between direct and indirect effects of crtY deletion on bacteriorhodopsin biogenesis?

Distinguishing between direct and indirect effects of crtY deletion on bacteriorhodopsin biogenesis requires a systematic approach:

  • Metabolite supplementation experiments:

    • Addition of β-carotene or retinal to crtY deletion strains should restore bacteriorhodopsin production if the effect is solely due to precursor limitation

    • Failure of supplementation to fully restore bacteriorhodopsin levels would suggest additional roles for crtY

  • Temporal analysis:

    • Detailed time-course studies of carotenoid metabolism and bacteriorhodopsin synthesis

    • Analysis of the kinetics of precursor utilization and product formation

  • Protein interaction studies:

    • Investigation of potential physical interactions between crtY and bacterioopsin or other proteins involved in bacteriorhodopsin assembly

    • Analysis of membrane organization and potential co-localization of carotenoid biosynthetic enzymes with bacteriorhodopsin assembly machinery

  • Comparative analysis with other mutations:

    • Comparison of crtY deletion phenotypes with those of mutations in other genes involved in carotenoid metabolism (e.g., brp, blh)

    • Analysis of double and triple mutants to assess genetic interactions

  • Transcriptional profiling:

    • RNA-seq or microarray analysis to identify genes whose expression is altered in crtY deletion strains

    • This can reveal potential regulatory links between carotenoid metabolism and bacteriorhodopsin synthesis

What experimental controls are essential when studying recombinant H. salinarum crtY expression in E. coli?

When studying recombinant H. salinarum crtY expression in E. coli, several essential controls must be included:

  • Vector-only control:

    • E. coli containing the expression vector without the crtY insert should not produce β-carotene

    • This control confirms that β-carotene production is specifically due to crtY expression

  • Induction time course:

    • Samples taken before induction should show no β-carotene production

    • Samples taken at different times after induction should show increasing β-carotene levels, demonstrating a correlation between crtY expression and activity

  • Inducer concentration series:

    • Different concentrations of inducer (e.g., arabinose) can provide information about the relationship between crtY expression level and activity

  • Positive control cyclases:

    • Expression of known functional lycopene cyclases from other organisms

    • This provides a benchmark for the activity of H. salinarum crtY

  • Product authentication:

    • HPLC comparison with authenticated standards

    • Spectroscopic analysis to confirm characteristic absorption spectra

    • Mass spectrometry to confirm molecular mass (e.g., 536.42 for β-carotene)

  • Protein expression verification:

    • Western blot or other protein detection methods to confirm that crtY is actually being expressed

    • Membrane fractionation to verify proper localization of the recombinant protein

These controls were effectively implemented in the described research, where the vector-only control showed no β-carotene production, the time-course samples showed increasing β-carotene levels after induction, and product authentication was performed using HPLC, UV-visible spectroscopy, and MALDI-TOF mass spectrometry .

What analytical techniques can be used to quantify and characterize carotenoids in H. salinarum?

Several analytical techniques can be employed to quantify and characterize carotenoids in H. salinarum:

  • High-Performance Liquid Chromatography (HPLC):

    • The primary method for separating and quantifying carotenoids

    • Different carotenoid species can be identified based on retention times

    • Standards are used for identification and quantification

    • As demonstrated in the research, HPLC can effectively separate lycopene (retention time 11.2 min) from β-carotene (retention time 13.2 min)

  • UV-Visible Spectroscopy:

    • Each carotenoid has characteristic absorption maxima and spectral features

    • For example, β-carotene has an absorbance maximum of 450 nm in isopropanol

    • This technique can be used for both identification and quantification

  • Mass Spectrometry:

    • MALDI-TOF mass spectrometry can confirm the identity of carotenoids based on molecular mass

    • For example, β-carotene has a mass ion value of 536.42

    • LC-MS/MS can provide additional structural information through fragmentation patterns

  • Nuclear Magnetic Resonance (NMR):

    • Provides detailed structural information about carotenoids

    • Requires larger amounts of purified material

    • Useful for confirming the identity of unknown carotenoids

  • Quantification methods:

    • External standard method: Using standard curves prepared with authenticated standards

    • Internal standard method: Adding a known amount of a non-native carotenoid

    • Results can be normalized to total cell protein or dry cell weight

How can the interaction between crtY and the membrane environment be studied?

Studying the interaction between crtY and the membrane environment requires specialized techniques:

  • Lipid composition analysis:

    • Determination of the lipid environment surrounding crtY using mass spectrometry

    • Analysis of preferential association with specific lipids

  • Reconstitution in artificial membrane systems:

    • Incorporation of purified crtY into liposomes or nanodiscs with defined lipid compositions

    • Assessment of activity in different lipid environments

  • Fluorescence techniques:

    • Fluorescence quenching to probe accessibility of specific residues

    • Fluorescence anisotropy to measure membrane fluidity around the protein

    • FRET to measure distances between protein domains or between protein and membrane

  • Molecular dynamics simulations:

    • In silico prediction of protein-membrane interactions

    • Simulation of protein behavior in different membrane environments

  • Electron microscopy:

    • Visualization of protein organization within the membrane

    • Analysis of potential clustering or domain formation

  • Membrane protein solubilization studies:

    • Differential extraction with various detergents

    • Assessment of protein stability and activity in various solubilized states

The fact that crtY is an integral membrane protein with multiple transmembrane segments suggests that its interaction with the membrane environment is likely crucial for its function. The proposed model suggesting direct interactions between crtY and other integral membrane proteins involved in bacteriorhodopsin biogenesis (like Brp and Blh) further emphasizes the importance of the membrane environment .

What are the potential applications of recombinant H. salinarum crtY in synthetic biology?

Recombinant H. salinarum crtY has several potential applications in synthetic biology:

  • Enhanced carotenoid production in heterologous hosts:

    • Engineering E. coli or other organisms for improved β-carotene production

    • Development of microbial cell factories for carotenoid synthesis

    • The demonstrated functionality of H. salinarum crtY in E. coli provides proof-of-concept for this application

  • Engineering novel carotenoid biosynthetic pathways:

    • Combination with other carotenoid biosynthetic enzymes to produce diverse carotenoid structures

    • Creation of hybrid enzymes through domain swapping with other cyclases

  • Optogenetic tools development:

    • Engineering systems for in vivo retinal production for optogenetic applications

    • Development of self-sufficient optogenetic systems that can produce their own chromophores

  • Membrane protein engineering:

    • Use as a model for understanding and engineering membrane protein topology

    • Development of membrane protein expression and purification strategies

  • Metabolic pathway regulation studies:

    • Investigation of regulatory mechanisms controlling carotenoid biosynthesis

    • Development of controllable expression systems for fine-tuning metabolic flux

The unique properties of H. salinarum crtY, including its membership in an evolutionarily distinct class of lycopene cyclases and its adaptation to the extreme halophilic environment of H. salinarum, make it a valuable addition to the synthetic biology toolkit.

What unexplored aspects of crtY function warrant further investigation?

Several aspects of crtY function remain unexplored and warrant further investigation:

  • Protein structure determination:

    • Crystallization or cryo-EM studies to determine the three-dimensional structure

    • Structure-function relationships, including identification of catalytic residues

  • Regulatory mechanisms:

    • Factors controlling crtY expression during bacteriorhodopsin biogenesis

    • Post-translational modifications affecting activity

    • Potential allosteric regulation by metabolites or other proteins

  • Protein-protein interactions:

    • Direct investigation of the proposed interactions with Brp and Blh

    • Identification of other protein partners involved in carotenoid metabolism

    • Analysis of potential membrane complexes involved in coordinated carotenoid and bacteriorhodopsin synthesis

  • Substrate specificity:

    • Investigation of activity on lycopene analogs or derivatives

    • Engineering altered substrate specificity through targeted mutations

  • Adaptation to extreme environments:

    • How crtY structure and function are adapted to the high-salt environment of H. salinarum

    • Comparative analysis with lycopene cyclases from non-extremophilic organisms

  • Role in synthesis of other rhodopsins:

    • Detailed analysis of crtY's role in the biogenesis of halorhodopsin and sensory rhodopsins I and II

    • Investigation of potential regulatory links between different rhodopsin biosynthetic pathways

The proposed model suggesting that crtY and related proteins are dedicated to producing β-carotene for use by other integral membrane proteins opens up exciting avenues for investigating the spatial and temporal coordination of carotenoid metabolism during bacteriorhodopsin biogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.