Recombinant Halobacterium salinarum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Definition and Overview of Recombinant Halobacterium salinarum Potassium-transporting ATPase C chain (kdpC)

The Recombinant Halobacterium salinarum Potassium-transporting ATPase C chain (kdpC) is a recombinant protein subunit of the KdpFABC complex, a high-affinity ATP-driven potassium uptake system in the extremophilic archaeon Halobacterium salinarum. This subunit is critical for maintaining potassium homeostasis under extreme environments, particularly in response to potassium limitation . The recombinant form is synthesized heterologously in host organisms such as E. coli or yeast, enabling structural, functional, and regulatory studies .

Key Features of kdpC

AttributeDetails
FunctionPart of the P-type ATPase complex facilitating K⁺ transport via ATP hydrolysis
Operon CompositionEncoded in the kdpFABCcat3 operon, along with subunits F, A, B, and cat3
RegulationExpression induced under K⁺ limitation (<20 µM), regulated by KdpQ and promoter Pkdp
Host OrganismsProduced in E. coli, yeast, or baculovirus systems
Purity>90% purity in liquid glycerol formulation

Comparative Analysis with Bacterial Kdp Systems

FeatureH. salinarum KdpFABCBacterial Kdp Systems (e.g., E. coli)
Subunit CompositionF, A, B, C (no homologs of kdpD/kdpE) F, A, B, C, D, E (sensor kinase/response regulator)
Regulatory MechanismKdpQ-dependent activation; promoter Pkdp KdpD/KdpE two-component system
Induction Threshold<20 µM K⁺ <10 mM K⁺
Growth DependencyEssential for survival below 20 µM K⁺ Auxiliary uptake under K⁺ limitation

Research Applications and Findings

The recombinant kdpC subunit is utilized in studies exploring its role in:

ATPase Activity and Ion Transport

  • Function: kdpC stabilizes the KdpFABC complex and modulates ATP hydrolysis, enabling K⁺ translocation against concentration gradients .

  • Key Insight: Deletion of kdpC (as part of kdpFABC) reduces growth under low K⁺, highlighting its necessity for extreme halophiles .

Transcriptional Regulation

  • Promoter Pkdp: Expression is induced ~50-fold under K⁺ limitation, mediated by KdpQ and the kdp promoter .

  • Operon Structure: The kdpFABCcat3 operon lacks bacterial regulators (kdpD/kdpE), suggesting an evolutionary divergence in regulatory mechanisms .

Adaptation to K⁺ Limitation

  • Cellular Response: H. salinarum decreases intracellular K⁺ levels under K⁺ stress, coupled with KdpFABC upregulation .

  • Experimental Evidence: Real-time RT-PCR shows kdpFABC transcripts peak at 20 µM K⁺, correlating with growth cessation .

Research Challenges and Future Directions

  1. Structural Elucidation: High-resolution crystallography of kdpC is needed to resolve its interactions with other subunits.

  2. Regulatory Dynamics: Mechanisms of KdpQ-mediated activation and Pkdp promoter regulation require further elucidation .

  3. Biotechnological Potential: Engineering kdpC for enhanced K⁺ uptake in industrial halophiles or crop plants under salinity stress.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; VNG_6178G; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
kdpC
Target Protein Sequence
MNRQDLAVPLRLLGVSLLVFGLLYQGSLMAIGDAVFPNSSAGSPVYVDGQEQPVGSQMIG QQFRPGQPEDVQYFWSRPSANDYNAMTSASTNWGPTNPLLSERVRADLQNISQYETPDDS VPVNLVSESGSSYDAHISPAAAEYQVLRVANQTGISEQRLNEMIDEATKEPWLGIWGHER VNVLELNLMVRDALNEQNETDQNSDMNASEIANGDH
Uniprot No.

Target Background

Function
The KdpC subunit is part of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing KdpB subunit through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the role of KdpC in the Halobacterium salinarum KdpFABC complex?

The KdpC subunit serves as a catalytic chaperone in the ATP-driven KdpFABC potassium uptake system of Halobacterium salinarum. Unlike conventional P-type ATPases, KdpC interacts directly with the nucleotide-binding loop of KdpB in an ATP-dependent manner around the ATP-binding pocket . This interaction is critical for high-affinity nucleotide binding to the KdpFABC complex, dramatically increasing ATP-binding affinity by forming a transient KdpB/KdpC/ATP ternary complex .

The KdpFABC complex in H. salinarum represents a chimeric transport system combining features of both ion pumps and ion channels, with KdpC facilitating ATP utilization through a mechanism that bears parallels to ABC transporters rather than traditional P-type ATPases . Experimental evidence indicates that KdpC significantly enhances the complex's affinity for ATP, making it essential for efficient potassium uptake under limiting conditions .

How does potassium transport influence the survival of Halobacterium salinarum in high-salt environments?

Potassium transport is fundamental to the survival of Halobacterium salinarum as an extreme halophile. These archaea balance high external osmolality by accumulating almost equimolar amounts of KCl within their cytoplasm, making steady potassium supply a vital prerequisite for survival . Unlike many bacteria that maintain turgor pressure, H. salinarum maintains an iso-osmotic equilibrium with its surrounding medium through this "salt-in" strategy .

The importance of efficient potassium transport becomes particularly evident under potassium-limiting conditions. H. salinarum exhibits a complex adaptation mechanism that includes:

  • Activation of high-affinity uptake systems like KdpFABC

  • Significant reduction of intracellular K+ levels

  • Transcriptional regulation of genes involved in potassium homeostasis

Research shows that H. salinarum cells with functional KdpFABC complexes can grow in environments with potassium concentrations as low as 20 μM, whereas cells lacking this system show reduced growth under potassium limitation . This demonstrates that while passive K+ uptake systems may suffice under potassium-rich conditions, the ATP-driven KdpFABC system becomes essential for survival when potassium is scarce.

What techniques are used to study recombinant KdpC expression in laboratory settings?

Studying recombinant KdpC expression requires specialized techniques adapted for halophilic proteins. Common methodologies include:

Expression Systems:

  • Modified E. coli expression systems with salt-adapted promoters

  • Native H. salinarum expression systems using inducible promoters

  • Cell-free expression systems with high salt concentrations

Purification Approaches:

  • Immobilized metal affinity chromatography (IMAC) with high-salt buffers (3-4M KCl or NaCl)

  • Size exclusion chromatography for final purification

  • On-column refolding methods when using non-halophilic expression hosts

Functional Analysis:

  • ATP binding assays using fluorescent ATP analogs such as TNP-ATP

  • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

  • Heteronuclear single quantum coherence (HSQC) NMR spectroscopy to examine protein-nucleotide interactions

For studying KdpC's interaction with KdpB, researchers commonly employ co-expression systems followed by pull-down assays or fluorescence resonance energy transfer (FRET) analysis. Real-time RT-PCR is effectively used to measure expression levels of the kdp genes under varying potassium concentrations, revealing the transcriptional regulation patterns .

What growth conditions are optimal for studying KdpC function in Halobacterium salinarum?

Optimal growth conditions for studying KdpC function in H. salinarum should balance cellular viability with experimental conditions that induce expression of the kdp genes. Based on research findings, the following parameters are recommended:

Salt Concentration:

  • Base medium: 4.3 M NaCl for optimal growth

  • K+ concentration variations:

    • Control conditions: >10 mM K+

    • Inducing conditions: 20 μM to 1 mM K+ (to trigger kdp expression)

Growth Parameters:

  • Temperature: 37-42°C

  • pH: 7.0-7.5

  • Aeration: Vigorous shaking or bubbling for aerobic conditions

Medium Composition:

ComponentStandard MediumK+-limiting Medium
NaCl4.3 M4.3 M
K+10-100 mM20 μM-1 mM
MgSO480 mM80 mM
Na3Citrate10 mM10 mM
Trace elementsAs neededAs needed

For optimal induction of the kdp system, researchers should monitor growth phases carefully, as expression patterns of the kdpFABCcat3 operon show both K+ concentration-dependent and growth phase-dependent regulation . Sampling for KdpC analysis is most informative during the transition from exponential to stationary phase under K+-limiting conditions.

How does the KdpC subunit's interaction with KdpB affect ATP binding and hydrolysis in the KdpFABC complex?

The KdpC subunit exerts a sophisticated molecular influence on ATP binding and hydrolysis through direct interactions with KdpB. This interaction represents a unique catalytic chaperone mechanism not observed in conventional P-type ATPases .

Mechanistically, KdpC increases the ATP binding affinity of the complex through:

  • Formation of a transient KdpB/KdpC/ATP ternary complex around the ATP-binding pocket

  • Direct interaction with the nucleotide-binding loop of KdpB in an ATP-dependent manner

  • Coordination of ATP via a conserved glutamine residue, similar to the LSGGQ signature motif in ABC transporters

Research has demonstrated that high-affinity nucleotide binding to the KdpFABC complex depends on this conserved glutamine residue in KdpC. Furthermore, both ATP binding and hydrolysis activity are highly sensitive to the accessibility, presence, or absence of hydroxyl groups at the ribose moiety of the nucleotide .

The following table summarizes the effects of KdpC on ATP binding and hydrolysis:

ParameterKdpB aloneKdpB + KdpCFunctional Impact
ATP binding affinityLowHighEnables function at low ATP concentrations
ATP hydrolysis rateLowerHigherIncreased energy efficiency
Nucleotide specificityBroadNarrowEnhanced selectivity for ATP
Conformational stabilityLess stableMore stableImproved catalytic cycling

These interactions suggest that KdpC evolved as an adaptation that allows the KdpFABC complex to function effectively under energy-limited conditions, providing a competitive advantage for H. salinarum in extreme environments.

How do mutations in specific residues of KdpC affect its catalytic chaperone function in the KdpFABC complex?

Mutations in specific KdpC residues can significantly impact its catalytic chaperone function, particularly those involved in ATP binding and interaction with KdpB. The conserved glutamine residue, reminiscent of the LSGGQ signature motif in ABC transporters, is especially critical for high-affinity nucleotide binding .

Key residues and their functional impacts include:

Residue TypeFunctionEffect of Mutation
Conserved glutamineATP coordination via hydrogen bondsDrastically reduced ATP binding affinity
Residues interacting with ribose hydroxyl groupsRecognition of ATP structureAltered nucleotide specificity
Residues in the KdpB-binding interfaceFormation of KdpB/KdpC/ATP ternary complexReduced complex stability and function

Experimental approaches to study these mutations typically involve:

  • Site-directed mutagenesis of the recombinant KdpC protein

  • Expression and purification of mutant proteins

  • Analytical techniques such as isothermal titration calorimetry (ITC) to measure binding affinity changes

  • Functional assays measuring ATP hydrolysis rates of reconstituted complexes

  • Structural studies using NMR or X-ray crystallography to visualize altered interactions

These mutation studies reveal that KdpC functions as a specialized adaptation that enhances the efficiency of the KdpFABC complex, particularly under conditions where ATP conservation is crucial. The precise structural arrangement of key residues has likely been optimized through evolution to maintain function in the extreme environments where H. salinarum thrives.

What insights can comparative studies between archaeal and bacterial KdpC provide about evolutionary adaptations to extreme environments?

Comparative studies between archaeal (H. salinarum) and bacterial (e.g., E. coli) KdpC proteins reveal fascinating evolutionary adaptations to different environmental niches and cellular physiologies. These comparisons offer insights into both convergent and divergent evolution of potassium transport systems.

Key comparative insights include:

  • Structural Adaptations: Archaeal KdpC shows specific amino acid compositions favoring acidic residues on the protein surface, a hallmark adaptation to high-salt environments. This contrasts with bacterial KdpC, which lacks these halophilic adaptations .

  • Regulatory Mechanisms: While bacterial kdp operons are regulated by the KdpD/KdpE two-component system, archaeal systems like H. salinarum incorporate the cat3 gene within the operon itself, suggesting fundamentally different regulatory strategies .

  • Physiological Context: Bacterial KdpFABC systems primarily function to maintain turgor pressure, whereas archaeal systems in halophiles like H. salinarum operate in an environment without turgor pressure, serving instead to maintain critical intracellular K+ concentrations for enzyme function and osmotic balance .

  • ATP Utilization: The catalytic chaperone function of KdpC appears to be conserved across domains, suggesting that this mechanism provides universal advantages for ATP efficiency, particularly valuable in extreme environments with limited energy resources .

The adaptations observed in archaeal KdpC highlight how a conserved protein framework can be modified to function effectively under radically different physiological constraints. These comparative insights not only illuminate evolutionary processes but also provide inspiration for protein engineering efforts aimed at creating stress-resistant biological systems.

How does the archaeal KdpFABC system differ functionally from its bacterial counterparts, and what methodologies best elucidate these differences?

The archaeal KdpFABC system in H. salinarum exhibits several key functional differences from its bacterial counterparts, reflecting adaptations to the unique physiological requirements of extreme halophiles. Understanding these differences requires specialized methodological approaches.

Key Functional Differences:

  • Osmotic Function: Unlike bacterial systems that maintain turgor pressure, the H. salinarum KdpFABC complex operates in cells without turgor pressure, functioning primarily to maintain the critical K+/Na+ balance necessary for cellular processes .

  • Salt Adaptation: The archaeal complex functions optimally in extremely high salt concentrations (4-5M), whereas bacterial systems typically operate in much lower salt environments .

  • Regulatory Integration: The archaeal system includes the cat3 gene within the kdp operon and lacks the KdpD/KdpE two-component regulatory system found in bacteria, suggesting fundamentally different control mechanisms .

  • Cellular K+ Management: H. salinarum can significantly decrease intracellular K+ levels as part of its adaptation to K+ limitation, a strategy not typically observed in bacterial systems .

Optimal Methodological Approaches:

Research QuestionRecommended MethodologyAdvantage for Archaeal Studies
Functional transportK+ uptake assays in membrane vesicles with high salt buffersMaintains native protein environment
ATP utilizationRadioisotope-based ATP hydrolysis assaysAllows quantification in high salt conditions
Protein-protein interactionsCross-linking studies combined with mass spectrometryIdentifies interfaces unique to archaeal systems
Structural featuresCryo-electron microscopy with high-salt sample preparationPreserves native conformation of halophilic proteins
Gene regulationChromatin immunoprecipitation followed by sequencing (ChIP-seq)Identifies regulatory factors without prior knowledge

When designing experiments to compare archaeal and bacterial systems, researchers should carefully control ionic conditions, as standard bacterial assay conditions may denature archaeal proteins. Conversely, the high salt requirements of archaeal proteins may inhibit bacterial enzyme functions, necessitating parallel experimental designs rather than direct side-by-side comparisons .

What experimental methods are most effective for studying the conformational changes in KdpC during ATP binding and hydrolysis?

Studying conformational changes in the KdpC subunit during ATP binding and hydrolysis presents unique challenges due to the halophilic nature of the protein and its interactions within the KdpFABC complex. The most effective experimental methods combine high-resolution structural techniques with dynamic functional assays.

Recommended Experimental Approaches:

  • Solution-State NMR Spectroscopy:

    • Heteronuclear single quantum coherence (HSQC) NMR with 15N-labeled KdpC

    • Allows detection of chemical shift perturbations upon ATP binding

    • Can be performed in high-salt buffers compatible with halophilic proteins

    • Reveals residue-specific information about conformational changes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Measures solvent accessibility changes upon ATP binding

    • Identifies regions of KdpC that undergo conformational rearrangements

    • Can be adapted for high-salt conditions with appropriate controls

    • Provides peptide-level resolution of dynamic changes

  • Fluorescence-Based Techniques:

    • Site-specific labeling of KdpC with environment-sensitive fluorophores

    • Fluorescence resonance energy transfer (FRET) between KdpC and KdpB

    • Stopped-flow kinetic measurements to capture transient states

    • Single-molecule FRET to observe conformational heterogeneity

  • Cross-linking Coupled with Mass Spectrometry:

    • Chemical cross-linking at different stages of the catalytic cycle

    • Identification of distance constraints between KdpC and KdpB

    • Mapping of the dynamic KdpB/KdpC/ATP ternary complex formation

  • Molecular Dynamics Simulations:

    • Complementary computational approach

    • Requires experimental structures as starting points

    • Provides atomic-level details of conformational transitions

    • Can incorporate high-salt environments in simulation parameters

Experimental Design Considerations:

When designing experiments to study KdpC conformational changes, researchers should consider:

  • The need for high salt concentrations (3-4M) in all buffers to maintain protein stability

  • The potential for ATP analogs (such as AMP-PNP) to trap specific conformational states

  • The importance of including the KdpB interaction partner for physiologically relevant conformations

  • The value of comparing apo, ATP-bound, and ADP-bound states to capture the complete cycle

These methodologies, when combined, provide a comprehensive picture of how KdpC contributes to the catalytic chaperone function in the KdpFABC complex through specific conformational changes during the ATP binding and hydrolysis cycle.

What are common challenges in expressing and purifying recombinant H. salinarum KdpC, and how can they be overcome?

Expression and purification of recombinant H. salinarum KdpC present several challenges stemming from its halophilic nature and functional properties. Researchers commonly encounter issues related to protein folding, solubility, and stability when working with this archaeal protein.

Common Challenges and Solutions:

ChallengeCauseSolution
Poor expression in E. coliCodon bias differencesUse codon-optimized gene or specialized E. coli strains
Protein aggregationHalophilic proteins misfold at low saltExpress with solubility tags (MBP, SUMO) or directly in high-salt buffers
Low solubilityHalophilic surface charge adaptationInclude 3-4M KCl or NaCl in all purification buffers
Protein instabilityDenaturation in standard buffersMaintain high salt concentration throughout all procedures
Co-purifying contaminantsNon-specific ionic interactionsUse gradient elution methods and additional purification steps
Loss of functional activityDenaturation during purificationInclude ATP or non-hydrolyzable analogs during purification

Advanced Purification Protocol:

  • Expression Strategy:

    • Use H. salinarum-optimized codons in expression vector

    • Express in C41(DE3) or C43(DE3) E. coli strains for membrane proteins

    • Include N-terminal His6-tag with a TEV protease cleavage site

    • Induce with low IPTG concentration (0.1-0.2 mM) at reduced temperature (18-20°C)

  • Lysis and Initial Purification:

    • Lyse cells in buffer containing 3M KCl, 50mM Tris-HCl pH 7.5, 5mM MgCl₂

    • Include protease inhibitors and 1mM ATP

    • Clarify lysate by ultracentrifugation (100,000×g, 1h)

    • Apply to Ni-NTA resin equilibrated with high-salt buffer

  • Chromatographic Purification:

    • Elute with imidazole gradient (20-250mM) in high-salt buffer

    • Apply to size exclusion chromatography column

    • Consider ion exchange chromatography with carefully optimized salt gradients

  • Activity Preservation:

    • Maintain 3M KCl or NaCl throughout all procedures

    • Add glycerol (10%) for freeze-storage

    • Store protein with 1mM ATP or AMP-PNP if studying the ATP-bound state

By implementing these strategies, researchers can overcome the challenges inherent in working with halophilic proteins and obtain functional recombinant KdpC suitable for detailed biochemical and structural studies.

How can transcriptomic approaches be used to study the global cellular response to potassium limitation in H. salinarum?

Transcriptomic approaches offer powerful insights into the global cellular responses of H. salinarum to potassium limitation, revealing not only the regulation of the kdp operon but also broader adaptation mechanisms. Modern transcriptomics methods can be effectively applied to this archaeal system with appropriate modifications.

Recommended Transcriptomic Approaches:

  • RNA-Seq Analysis:

    • Total RNA extraction under varying K+ concentrations

    • Differential RNA-seq (dRNA-seq) to distinguish primary from processed transcripts

    • Identification of transcriptional processing sites (TPS) related to K+ stress response

    • Revealing antisense transcripts and non-coding RNAs involved in regulation

  • Time-Series Transcriptomics:

    • Sampling across the adaptation process to K+ limitation

    • Identification of early, intermediate, and late response genes

    • Clustering of co-regulated genes to identify regulatory networks

    • Correlation of transcript changes with physiological parameters

  • Comparative Transcriptomics:

    • Wild-type vs. Δkdp mutant strains under K+ limitation

    • Analysis of cat3 deletion effects on global transcription patterns

    • Cross-species comparison with other halophiles

    • Integration with other -omics data (proteomics, metabolomics)

Experimental Design for Transcriptomic Studies:

Experimental ConditionK+ ConcentrationGrowth PhasePurpose
K+ excess100 mMMid-logBaseline expression profile
Mild K+ limitation1-5 mMMid-logEarly adaptive response
Severe K+ limitation20-50 μMMid-logStress response activation
Time course20 μMEarly log to stationaryTemporal adaptation patterns

Data Analysis Strategies:

  • Differential Expression Analysis:

    • Identify significantly up/down-regulated genes using DESeq2 or similar tools

    • Focus on K+ transport systems beyond KdpFABC

    • Analyze changes in energy metabolism genes (ATP production)

    • Examine osmoregulation and compatible solute biosynthesis pathways

  • Network Analysis:

    • Construct gene co-expression networks

    • Identify hub genes and regulatory motifs

    • Compare with existing environmental/gene regulatory influence networks

    • Predict transcriptional regulators using promoter motif analysis

  • Integration with Physiological Data:

    • Correlate transcript changes with intracellular K+ measurements

    • Relate expression patterns to growth rates and cell morphology

    • Connect transcriptional changes to ATP utilization metrics

    • Develop predictive models of K+ homeostasis mechanisms

By applying these transcriptomic approaches, researchers can develop a systems-level understanding of how H. salinarum coordinates its global cellular response to potassium limitation, potentially revealing novel regulatory mechanisms and adaptation strategies unique to archaea or extreme halophiles.

What are the most promising research directions for understanding the structure-function relationship of H. salinarum KdpC?

Understanding the structure-function relationship of H. salinarum KdpC represents a frontier in archaeal membrane transport research. Several high-potential research directions could significantly advance our understanding of this unique catalytic chaperone:

  • High-Resolution Structural Determination:

    • Cryo-electron microscopy of the complete KdpFABC complex under various nucleotide-bound states

    • X-ray crystallography of KdpC alone and in complex with the KdpB nucleotide-binding domain

    • Solution NMR structures of KdpC in high-salt conditions

    • Comparative structural analysis with bacterial homologs

  • Molecular Basis of ATP Binding:

    • Detailed characterization of the ATP-binding pocket through mutagenesis studies

    • Investigation of the conserved glutamine residue's role in nucleotide coordination

    • Exploration of how salt concentration affects nucleotide binding specificity

    • Thermodynamic and kinetic analysis of the ATP binding mechanism

  • KdpB-KdpC Interface Dynamics:

    • Mapping the specific residues involved in KdpB-KdpC interactions

    • Investigating how these interactions change during the catalytic cycle

    • Developing small molecule modulators of the KdpB-KdpC interaction

    • Understanding the evolutionary conservation of this interface across archaeal species

  • Halophilic Adaptations:

    • Analysis of acidic residue distribution and salt-dependent folding mechanisms

    • Comparison with non-halophilic KdpC homologs to identify halophilic adaptations

    • Engineering of halophilic features into non-halophilic homologs as a test of function

    • Molecular dynamics simulations in high-salt environments

  • Integrated Structural Biology Approaches:

    • Combining data from multiple structural methods (X-ray, NMR, cryo-EM, HDX-MS)

    • Developing integrative models of the complete KdpFABC complex in various states

    • Correlating structural features with functional data from transport assays

    • Using computational approaches to model conformational changes during transport

These research directions would not only advance our understanding of archaeal potassium transport but could also reveal fundamental principles about protein adaptation to extreme environments and the evolution of ATP-driven transport systems across domains of life.

How might synthetic biology approaches utilize KdpC to engineer salt-tolerant organisms for biotechnological applications?

Synthetic biology approaches utilizing H. salinarum KdpC and related components of the KdpFABC system offer promising strategies for engineering salt-tolerant organisms with various biotechnological applications. The unique properties of this archaeal system could be leveraged in several innovative ways:

  • Engineering Salt-Tolerant Crop Plants:

    • Introduction of archaeal kdpC with appropriate modifications for eukaryotic expression

    • Co-expression with other components of the KdpFABC system to enhance K+ uptake

    • Integration with plant osmoregulatory pathways to improve drought and salinity tolerance

    • Development of salt-tolerant food crops for marginal agricultural lands

  • Creating Extremophilic Production Strains:

    • Engineering industrial microorganisms with archaeal potassium transport systems

    • Development of bioreactors operating under high-salt conditions to prevent contamination

    • Creation of robust biocatalysts for high-salt industrial processes

    • Enhancing bioremediation organisms for saline-contaminated environments

  • Protein Engineering Applications:

    • Using KdpC as a scaffold to develop halophilic enzymes with industrial applications

    • Exploring the catalytic chaperone mechanism as a model for designing ATP-efficiency enhancers

    • Creating chimeric transport systems with novel substrate specificities

    • Engineering proteins with enhanced stability in non-conventional solvents

  • Chassis Organism Development:

    • Creation of synthetic minimal cells with archaeal K+ transport systems

    • Development of chassis organisms capable of growing in extreme environments

    • Engineering metabolic pathways that function optimally under high-salt conditions

    • Creating biological containment systems based on salt-dependency

  • Biosensor Development:

    • Utilizing the K+-sensing properties of the Kdp system to develop biosensors

    • Creating synthetic circuits that respond to potassium limitation

    • Developing reporter systems for environmental monitoring of salt stress

    • Engineering cell-based diagnostics for ion imbalances

Key Research Requirements for These Applications:

Application AreaRequired ResearchTechnical Challenges
Plant engineeringAdaptation of archaeal genes for plant expressionMaintaining protein function in plant cellular environment
Microbial chassisIntegration with existing transport systemsAvoiding interference with native ion homeostasis
Enzyme engineeringUnderstanding salt-adaptation principlesBalancing activity with stability
Biosensor developmentIdentifying minimal sensing componentsCreating appropriate signal transduction mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.