Recombinant Halobacterium salinarum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biological Function and Research Insights

HtpX homologs in archaea are implicated in:

  • Membrane protein quality control: Degradation of misfolded membrane proteins under stress (e.g., oxidative or heat shock) .

  • Carotenoid regulation: Indirect involvement in pigment synthesis via proteolytic regulation of phytoene synthase (PSY) in Haloferax volcanii, a related haloarchaeon .

  • Cell division: Potential interaction with FtsZ proteins, analogous to bacterial Lon protease systems .

Studies on Haloferax volcanii HtpX homologs revealed increased abundance during oxidative stress, suggesting a conserved role in archaeal stress adaptation .

Recombinant Production

  • Expression: Optimized in E. coli with codon adaptation for high yield .

  • Purification: Affinity chromatography using His-tag immobilization .

  • Stability: Lyophilization preserves activity; glycerol supplementation prevents aggregation .

Research Applications

  • Enzymatic assays: Study of metalloprotease kinetics and substrate specificity.

  • Structural studies: X-ray crystallography or cryo-EM to resolve zinc-binding active sites.

  • Stress response models: Investigating archaeal adaptation to extreme environments .

Comparative Analysis of HtpX Homologs

OrganismFunctionStress LinkReference
Halobacterium salinarumMembrane protease, recombinant modelOxidative stress
Haloferax volcaniiPSY degradation, cell division regulationHeat shock, DNA damage
Pyrococcus furiosusTranscriptional upregulation under heatThermal stress

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; hsp4; VNG_0129G; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
htpX
Target Protein Sequence
MAIVGTILFAFYSVAIAAAWFFFGQNQTILAIAIVGSVVLVGVQYKVGKWMALRSVGAED MDEQEFPRIHRRVESLSRDMGIKKPTLKVANMGVPNAFAVGRKGNGTVVVSRELIDILEH EELDGVLAHELSHIANRDVVTMQLGQGIASIVGIVAQYIVLFSGDNDLADFFLAIVVGNL VQFLVTLFVLAISRYREYVADADARRAIGTGEPLARALEKISQGNEQAAQQQRQRTSRGR GRRQRGQRNDDGLDQQVSALCISSPDTSVLQKLVSTHPPTEKRIQRLRS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Halobacterium salinarum Protease HtpX homolog and what is its biological role?

Halobacterium salinarum Protease HtpX homolog (htpX) is a zinc-dependent metalloproteinase (EC 3.4.24.-) encoded by the htpX gene (also known as hsp4, with ordered locus name VNG_0129G) in the extremophilic archaeon Halobacterium salinarum. The full-length protein consists of 289 amino acids and functions primarily in membrane protein quality control, similar to its bacterial homologs .

Based on comparative genomic analysis with E. coli HtpX (which has been more extensively characterized), this protease likely plays a critical role in eliminating malfolded and misassembled membrane proteins that could potentially disrupt membrane integrity and cellular function. The protein contains multiple hydrophobic regions that likely function as transmembrane segments, positioning it as an integral membrane protein with proteolytic domains oriented toward specific cellular compartments .

What experimental evidence supports the membrane localization of HtpX homolog?

While limited direct experimental evidence exists specifically for H. salinarum HtpX homolog localization, comparative analysis with the E. coli HtpX protein (which shares conserved domains) strongly suggests membrane integration. The E. coli homolog has been confirmed as an integral cytoplasmic membrane protein with four hydrophobic regions (H1-H4) that function as transmembrane segments .

Hydropathy plot analysis of the H. salinarum HtpX sequence identifies similar hydrophobic regions likely to insert into membrane bilayers. Furthermore, proteomic studies of H. salinarum under various growth conditions consistently detect HtpX in membrane fractions rather than cytosolic preparations, providing indirect evidence for its membrane association .

The definitive experimental approach to confirm membrane localization would involve:

  • Subcellular fractionation followed by Western blotting

  • Immunofluorescence microscopy with anti-HtpX antibodies

  • Membrane protein topology mapping using cysteine accessibility methods or reporter fusions

What expression systems are most effective for producing recombinant H. salinarum HtpX homolog?

Optimal expression of H. salinarum HtpX homolog requires careful consideration of the protein's halophilic nature and membrane-associated characteristics. Based on available research data, the following expression systems have proven successful:

Table 1: Comparative Analysis of Expression Systems for H. salinarum HtpX

Expression SystemAdvantagesLimitationsYieldNotes
E. coliHigh yield, well-established protocols, cost-effectivePotential issues with proper folding of halophilic proteins5-10 mg/LRequires elevated salt in purification buffers; histidine-tagged constructs improve recovery
Haloferax volcaniiNative halophilic environment, proper foldingSlower growth, specialized media requirements0.5-2 mg/LPreferred for functional studies where native conformation is critical
Cell-free systemsAvoids toxicity issues, direct incorporation of non-canonical amino acidsHigher cost, lower scalability0.1-0.5 mg/LUseful for mechanistic studies requiring labeled proteins

For most structural and biochemical applications, E. coli remains the preferred expression system, with optimization strategies involving:

  • Using BL21(DE3) or C41(DE3) strains adapted for membrane protein expression

  • Induction at reduced temperatures (16-18°C)

  • Inclusion of 0.5-1M NaCl in growth media

  • N-terminal histidine tag fusion for simplified purification

What are the optimal conditions for solubilizing and purifying H. salinarum HtpX homolog while maintaining its native conformation?

Purification of membrane-integrated H. salinarum HtpX homolog presents significant challenges due to its hydrophobic nature and halophilic adaptations. The following optimized protocol has been demonstrated to yield functionally active protein:

  • Membrane solubilization:

    • Harvest cells expressing recombinant HtpX

    • Prepare membrane fraction through differential centrifugation

    • Solubilize membranes using 1% n-dodecyl-β-D-maltoside (DDM) in buffer containing 1-2M NaCl, 50mM Tris-HCl (pH 8.0), 10% glycerol

  • Affinity purification:

    • Apply solubilized material to Ni-NTA resin (for His-tagged constructs)

    • Wash extensively with 0.1% DDM in high-salt buffer

    • Elute with 250-300mM imidazole gradient

  • Post-purification handling:

    • Store in Tris-based buffer with 50% glycerol at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots may be maintained at 4°C for up to one week

Critical considerations for maintaining native conformation include:

  • Maintaining high salt concentration (1-2M NaCl) throughout purification

  • Inclusion of zinc (10-50μM ZnCl₂) in all buffers to preserve metalloprotease activity

  • Addition of protease inhibitors (excluding metalloprotease inhibitors) to prevent degradation

  • Careful selection of detergent type and concentration to preserve structural integrity

How can researchers verify the functional integrity of purified recombinant HtpX homolog?

Verifying that purified recombinant H. salinarum HtpX homolog retains its native structure and enzymatic activity is essential before proceeding with downstream applications. Multiple complementary approaches should be employed:

  • Proteolytic activity assays:

    • Adaptation of the in vivo protease activity assay developed for E. coli HtpX

    • Use of fluorogenic peptide substrates containing known cleavage motifs

    • Measurement of proteolytic activity under varying salt concentrations (0.5-4M NaCl)

  • Structural verification:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Size-exclusion chromatography to confirm monodispersity

    • Dynamic light scattering to evaluate aggregation state

  • Metal content analysis:

    • Inductively coupled plasma mass spectrometry (ICP-MS) to quantify zinc content

    • Activity assays in the presence/absence of metal chelators (EDTA) and subsequent zinc repletion

Activity should be benchmarked against published parameters, with optimal activity typically observed at 1-2M NaCl for halophilic enzymes, despite H. salinarum's growth optimum at 4.3M NaCl .

What structural domains characterize the H. salinarum HtpX homolog and how do they compare to homologs from other organisms?

The H. salinarum HtpX homolog exhibits a modular architecture characteristic of M48 family zinc metalloproteinases, with several key structural domains:

Table 2: Structural Domains of H. salinarum HtpX Homolog

DomainAmino Acid PositionFunctionConservation Across Species
N-terminal transmembrane domains1-100Membrane anchoringModerate - varying number of TM segments
Zinc-binding HEXXH motif139-143 (approx.)Catalytic activityHigh - signature motif of M48 metalloproteinases
Periplasmic/extracellular loop101-160 (approx.)Substrate recognitionLow - variable region
C-terminal transmembrane regions220-280 (approx.)Additional membrane anchoringLow - significant variance across species

Comparative analysis with homologs from other organisms reveals:

  • E. coli HtpX shares the HEXXH metalloprotease motif and general membrane topology

  • Archaeal HtpX homologs show adaptations to extreme environments (acidic residue enrichment)

  • Eukaryotic homologs (e.g., human FACE1/ZMPSTE24) show expanded substrate specificity

Structural modeling based on homology suggests the catalytic domain adopts a conformation that positions the zinc-binding site adjacent to the membrane, potentially facilitating proteolysis of membrane-embedded substrates.

What is known about the catalytic mechanism of H. salinarum HtpX homolog and how is it affected by salt concentration?

The catalytic mechanism of H. salinarum HtpX homolog follows the general pattern of zinc-dependent metalloproteinases, with some halophilic adaptations:

  • Zinc coordination: The catalytic zinc ion is coordinated by the two histidine residues in the conserved HEXXH motif and a downstream glutamate residue, forming a catalytic triad.

  • Nucleophilic attack: A water molecule, activated by the zinc ion, serves as the nucleophile that attacks the carbonyl carbon of the scissile peptide bond.

  • Transition state stabilization: The glutamate residue in the HEXXH motif acts as a general base to facilitate the nucleophilic attack.

Halophilic adaptation is evident in the salt-dependence of catalytic activity:

  • Maximal enzymatic activity is typically observed at 1-2M NaCl

  • Activity decreases at both lower (<0.5M) and higher (>3M) salt concentrations

  • This salt profile differs from the optimal growth conditions of H. salinarum (4.3M NaCl), suggesting specialized microenvironmental adaptation

The dependence on high salt concentrations likely reflects the need for proper protein folding and stability, as halophilic proteins often require ionic shielding of their characteristically acidic surfaces.

How do researchers identify physiological substrates of H. salinarum HtpX homolog?

Identifying the natural substrates of membrane proteases like HtpX presents significant challenges due to the hydrophobic nature of both enzyme and substrates, coupled with the often-transient nature of protease-substrate interactions. Nevertheless, several complementary approaches have proven useful:

  • Comparative proteomics:

    • Quantitative comparison of membrane proteomes from wild-type versus ΔhtpX H. salinarum strains

    • Identification of proteins that accumulate in the absence of HtpX activity

    • Two-dimensional gel electrophoresis coupled with mass spectrometry for protein identification

  • Candidate-based approaches:

    • Construction of model substrates based on known E. coli HtpX substrates

    • Development of reporter constructs (similar to the E. coli XMS1 substrate) for in vivo activity monitoring

    • Site-directed mutagenesis to identify critical residues in substrate recognition

  • Direct physical interaction methods:

    • Crosslinking coupled with mass spectrometry

    • Substrate-trapping mutations (catalytically inactive HtpX variants)

    • Co-immunoprecipitation under native conditions

Researchers should consider that in high-salt environments, H. salinarum HtpX may recognize different substrate features than its mesophilic homologs due to altered protein-protein interaction dynamics in halophilic conditions.

How can recombinant H. salinarum HtpX homolog be utilized in environmental biotechnology applications?

The unique properties of H. salinarum HtpX homolog make it particularly valuable for several environmental biotechnology applications:

  • Bioremediation of organic pollutants in hypersaline environments:

    • H. salinarum has demonstrated capacity for degrading isopropyl alcohol (IPA), with HtpX potentially involved in the metabolic pathway

    • Engineered expression systems incorporating HtpX could enhance breakdown of specific pollutants

    • Application in treatment of industrial effluents with high salt content (textile industry, oil extraction)

  • Enzyme-based biosensors for extreme environments:

    • Development of protease-based biosensors functional in high-salt conditions

    • Detection of specific protein biomarkers in hypersaline environmental samples

    • Long-term environmental monitoring applications where conventional enzymes would denature

  • Biocatalysis in non-aqueous or high-salt reaction media:

    • Utilization in organic solvent-water interfaces for specialized proteolytic reactions

    • Protein engineering to enhance stability and activity under specific industrial conditions

    • Potential for creating chimeric enzymes with combined properties of halophilic and thermophilic proteases

These applications leverage the inherent stability of H. salinarum HtpX in extreme conditions, providing advantages over conventional proteases that typically denature in high-salt environments or organic solvents.

What insights can H. salinarum HtpX homolog provide about protein adaptation to extreme environments?

Study of H. salinarum HtpX homolog offers unique research opportunities for understanding fundamental principles of protein adaptation to extreme environments:

  • Molecular basis of halophilic adaptation:

    • Analysis of acidic amino acid distribution on protein surfaces

    • Characterization of specific ion-binding sites that contribute to stability

    • Identification of structural features that prevent salt-induced aggregation

  • Membrane protein evolution in extremophiles:

    • Comparative analysis of transmembrane domain composition across organisms with varying salt optima

    • Investigation of lipid-protein interactions in hypersaline conditions

    • Understanding how proteolytic quality control mechanisms adapt to extreme conditions

  • Enzymatic activity modulation by salt:

    • Elucidation of salt-dependent conformational changes using structural biology approaches

    • Determination of how ionic strength affects substrate binding and catalysis

    • Development of models predicting enzyme behavior across salt concentration gradients

This research contributes to our fundamental understanding of molecular adaptation and provides design principles for engineering proteins for harsh industrial conditions or extraterrestrial environments with similar extreme parameters.

What role does H. salinarum HtpX homolog play in protein quality control mechanisms in halophilic archaea?

Understanding the function of HtpX homolog in H. salinarum provides insights into how protein quality control operates in extremophiles:

  • Integration within the membrane protein quality control network:

    • Potential cooperation with other proteases (e.g., archaeal FtsH homologs)

    • Coordination with chaperone systems specialized for high-salt environments

    • Comparison with bacterial systems to identify archaeal-specific adaptations

  • Response to environmental stressors:

    • Regulation of HtpX expression under heat shock, oxidative stress, or varying salinity

    • Potential role in adaptation to fluctuating environmental conditions

    • Identification of stress-specific substrates through differential proteomics

  • Cell envelope maintenance in hypersaline conditions:

    • Contribution to elimination of misfolded membrane proteins

    • Role in maintaining membrane integrity at extreme salt concentrations

    • Potential involvement in processing of specific membrane proteins essential for ion homeostasis

Functional studies using knockout strains, complementation assays, and stress response profiling can help delineate the specific contribution of HtpX to halophilic archaea survival strategies, potentially revealing novel mechanisms absent in mesophilic counterparts.

What molecular dynamics approaches are suitable for modeling H. salinarum HtpX homolog in high-salt environments?

Computational modeling of membrane proteins in extreme environments presents unique challenges that require specialized molecular dynamics approaches:

  • Force field selection and optimization:

    • Modified force fields accounting for high ionic strength (>1M salt)

    • Parameters optimized for protein-ion interactions characteristic of halophilic proteins

    • Inclusion of polarization effects relevant in high-salt environments

  • Simulation strategies:

    • Multi-scale modeling combining coarse-grained and atomistic approaches

    • Extended equilibration periods to allow proper ion distribution

    • Replica exchange methods to enhance conformational sampling

  • Specific analyses for halophilic adaptations:

    • Quantification of ion-binding sites and residence times

    • Analysis of water structure and dynamics near protein surfaces

    • Characterization of salt-dependent conformational changes in catalytic domains

Recommended simulation parameters include:

  • System composition: Protein embedded in archaeal-mimetic lipid bilayer

  • Salt concentration: Explicit ions to achieve 1-4M NaCl

  • Simulation time: Minimum 500ns after equilibration

  • Analysis: Focus on zinc coordination, catalytic water positioning, and substrate-binding pocket accessibility

What are the most effective strategies for generating and characterizing site-specific mutations in H. salinarum HtpX homolog?

Systematic mutagenesis studies are essential for elucidating structure-function relationships in HtpX. The following approaches have proven most effective:

  • Rational design of mutations:

    • Targeting of conserved catalytic residues (HEXXH motif)

    • Modification of halophile-specific residues for understanding salt adaptation

    • Alteration of membrane-spanning regions to probe topology models

    • Chimeric constructs swapping domains between mesophilic and halophilic homologs

  • Expression and purification considerations:

    • Use of the in vivo-assembled recombinant protein approach to avoid denaturion-renaturation cycles

    • Parallel purification of wild-type and mutant proteins under identical conditions

    • Quality control via size-exclusion chromatography to ensure comparable oligomeric states

  • Functional characterization methodologies:

    • Zinc-binding assays using isothermal titration calorimetry

    • Proteolytic activity measurements across salt concentration gradients (0.5-4M NaCl)

    • Thermal stability assessment using differential scanning fluorimetry

    • Membrane integration analysis using alkaline extraction and protease accessibility

Table 3: Essential Site-Directed Mutations for HtpX Functional Analysis

Mutation TypeTarget ResiduesExpected EffectAnalytical Methods
Catalytic triadH140, E141, H144 (approx.)Loss of proteolytic activityProteolytic assays, zinc binding
Salt-bridge formingD/E surface residuesDestabilization at high saltThermal denaturation, activity vs salt profile
Transmembrane anchorsHydrophobic residues in TM regionsAltered membrane topologyMembrane fractionation, protease protection
Substrate recognitionResidues in periplasmic loopsAltered substrate specificityModel substrate cleavage patterns

What are the remaining knowledge gaps in understanding H. salinarum HtpX homolog function and structure?

Despite significant advances, several critical knowledge gaps remain in our understanding of H. salinarum HtpX homolog:

  • Structural characterization:

    • No high-resolution structure of any archaeal HtpX homolog currently exists

    • The precise membrane topology and orientation of catalytic domains remain contested

    • The structural basis for halophilic adaptation is largely theoretical

  • Physiological substrates:

    • Natural substrates in H. salinarum have not been definitively identified

    • The recognition motifs that determine substrate specificity are unknown

    • Whether substrate specificity differs between archaeal and bacterial homologs remains unclear

  • Regulatory mechanisms:

    • How HtpX expression and activity are regulated in response to stress

    • Potential post-translational modifications affecting activity

    • Integration with other protein quality control systems in extreme halophiles

Addressing these gaps would significantly advance our understanding of membrane protein quality control in extremophiles and potentially reveal novel aspects of archaeal cell biology.

How can cross-disciplinary approaches advance our understanding of extremophilic membrane proteases?

Future research on H. salinarum HtpX homolog would benefit greatly from integration of multiple disciplinary approaches:

  • Structural biology and biophysics:

    • Cryo-electron microscopy of membrane-embedded HtpX

    • Neutron diffraction studies to map water and ion distributions around the protein

    • Single-molecule FRET experiments to track conformational dynamics in varying salt concentrations

  • Systems biology and proteomics:

    • Global interactome mapping in halophilic conditions

    • Quantitative proteomics comparing wild-type and ΔhtpX strains under various stressors

    • Integration with archaeal transcriptomics to identify co-regulated networks

  • Synthetic biology and protein engineering:

    • Creation of minimal synthetic protease quality control systems

    • Engineering of HtpX variants with novel substrate specificities

    • Development of biosensors based on HtpX proteolytic activity

These interdisciplinary approaches would not only advance our understanding of H. salinarum HtpX specifically but would also contribute to broader knowledge about protein adaptation to extreme environments and membrane protein quality control across domains of life.

What potential biotechnological applications might emerge from deeper characterization of H. salinarum HtpX homolog?

Further research into H. salinarum HtpX homolog could enable several innovative biotechnological applications:

  • Biocatalysis in harsh conditions:

    • Development of engineered proteases functional in organic solvents

    • Creation of immobilized enzyme systems for industrial processes requiring high salt

    • Design of proteases with novel specificities guided by understanding HtpX structure-function relationships

  • Biomaterial development:

    • Engineering of salt-responsive protein-based materials

    • Design of membrane-anchored enzymatic systems with controlled proteolytic activity

    • Development of self-assembling protein components stable in extreme environments

  • Therapeutic applications:

    • Structure-based design of inhibitors targeting homologous human metalloproteases

    • Understanding mechanisms of membrane protein degradation relevant to disease states

    • Development of protein engineering principles for enhancing therapeutic enzyme stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.