Recombinant Halobacterium salinarum Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant crcB1 is synthesized using E. coli expression systems, followed by affinity chromatography via its His-tag . Critical parameters include:

ParameterSpecification
Expression SystemE. coli (in vitro)
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based with 50% glycerol, pH 8.0
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Functional Insights

While direct functional data for H. salinarum crcB1 is limited, comparative genomic studies suggest roles in:

  • Ion Transport: Homologs in Mycobacterium species mediate fluoride efflux, suggesting crcB1 may regulate halide homeostasis in high-salt environments .

  • Stress Response: Co-expression with RNA-binding proteins (e.g., SmAP1) and RNases in H. salinarum hints at post-transcriptional regulatory roles .

Notably, 54% of H. salinarum genes undergo post-transcriptional regulation, with crcB1 potentially subject to RNase_2099C-mediated processing .

Research Applications

Recombinant crcB1 is utilized in:

  • Structural Studies: Membrane protein crystallization and topology mapping .

  • Functional Assays: Ion transport kinetics under hypersaline conditions .

  • Proteomic Surveys: Detected in H. salinarum PeptideAtlas, confirming its expression in native contexts .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB1; VNG_1919H; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
crcB1
Target Protein Sequence
MTGAVAPPAVLVAAGGALGAVLRWRVVAATPTTEYPAGTLVVNVVGSFVLAALTFAAADA DTMLLFGTGACGAFTTFASFSVDVVALVDADRPVAAAGHALGNLLGAGLAVALAWLLVA
Uniprot No.

Target Background

Function
Crucial for reducing fluoride concentration within cells, thereby minimizing its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Halobacterium salinarum CrcB homolog 1?

While Escherichia coli is commonly used for heterologous protein expression, it presents significant challenges for halophilic archaeal proteins like CrcB homolog 1. Halophilic proteins often fail to fold properly when expressed in E. coli, resulting in degradation or insoluble aggregates .

For superior results, Haloferax volcanii is strongly recommended as an expression host for CrcB homolog 1 due to:

  • Natural adaptation to high salt environments

  • Established genetic manipulation protocols

  • Demonstrated success with overexpressing archaeal proteins at medium and large scales

  • Compatible cellular machinery for proper protein folding

The expression protocol involves:

  • Gene synthesis with appropriate restriction sites

  • Cloning into a vector like pTA1392 with a 6xHis-tag for purification

  • Transformation into H. volcanii via established methods

  • Culture in appropriate high-salt media

What is known about Halobacterium salinarum genomic organization that affects CrcB homolog 1 research?

Halobacterium sp. NRC-1 possesses a complex 2,571,010-bp genome organized into three circular replicons:

  • A main chromosome (2,014,239 bp) with 67.9% GC content

  • Two smaller replicons: pNRC100 (191,346 bp) and pNRC200 (365,425 bp) with 57.9% and 59.2% GC content, respectively

The genome contains 91 insertion sequence (IS) elements representing 12 families, which contribute to its genomic plasticity . When designing primers or expression strategies for CrcB homolog 1, researchers must account for this dynamic genome structure to ensure target specificity.

While the genome codes for 2,630 predicted proteins, approximately 36% have no previously reported homologs , which presents both challenges and opportunities when characterizing proteins like CrcB homolog 1.

What growth conditions are optimal for Halobacterium salinarum cultures prior to CrcB homolog 1 extraction?

For consistent results when cultivating Halobacterium salinarum NRC-1 (JCM 11081) prior to protein extraction, the following conditions are recommended:

  • Growth medium: Complex medium (CM) containing:

    • 4.28 M NaCl

    • 81 mM MgSO₄·7H₂O

    • 27 mM KCl

    • 10 mM trisodium-citrate·2H₂O

    • 1% (w/v) peptone

    • pH adjusted to 7.4

  • Culture conditions:

    • 37°C

    • 180 rpm (orbital shaking)

    • Oxic conditions

    • Growth in glassware thoroughly rinsed with MilliQ water to remove detergent traces

  • Harvesting point:

    • Stationary phase (OD₆₀₀ = 1.0–1.6)

    • Avoid decline phase to approximate natural physiological conditions

When monitoring growth for optimal protein expression, track culture density using spectrophotometry at 600 nm.

What purification methods yield the highest quality recombinant CrcB homolog 1 protein?

Based on successful approaches with other Halobacterium salinarum proteins, the following purification strategy is recommended:

  • Initial extraction:

    • Harvest cells at optimal density

    • Resuspend in high-salt buffer to maintain protein stability

    • Cell lysis via sonication or pressure homogenization while maintaining sample temperature below 10°C

  • Affinity chromatography:

    • For His-tagged CrcB homolog 1, use Ni-NTA affinity chromatography

    • Maintain high salt concentration (2-4 M) in all buffers

    • A stepwise imidazole gradient for elution is recommended

  • Yield assessment:

    • Expected yield: 80-85% recovery based on similar halophilic proteins

    • Molecular weight verification via SDS-PAGE (predicted size should be confirmed)

What are the critical factors to consider when assessing CrcB homolog 1 stability and activity?

When characterizing CrcB homolog 1, consider these key parameters:

  • Salt dependence:

    • Maintain high salt concentrations (2-4 M NaCl) during all handling steps

    • Test protein stability across a salt gradient (1-5 M) to determine optimal conditions

    • Monitor activity changes at different salt concentrations

  • Metal ion effects:

    • Test stability in the presence of various metal ions (similar to other Halobacterium proteins)

    • Pay particular attention to physiologically relevant ions (Mg²⁺, K⁺, Fe²⁺/³⁺)

  • Solvent compatibility:

    • For structural studies, assess stability in organic solvents

    • Certain solvents (diethyl ether, n-hexane) may be tolerated better than others

    • Determine critical concentrations for activity retention

  • Temperature and pH profiles:

    • Establish activity curves across temperature range (10-60°C)

    • Determine optimal pH for activity and stability

How do halophilic adaptations in CrcB homolog 1 affect experimental design?

Halophilic proteins like CrcB homolog 1 possess unique adaptations that require special consideration:

  • Surface charge distribution:

    • Increased acidic residues (Asp, Glu) on protein surface

    • Decreased hydrophobic amino acids in the protein core

    • These adaptations necessitate high salt conditions for proper folding

  • Crystallization challenges:

    • Traditional crystallization methods often fail

    • Specialized screens with high salt concentrations required

    • Consider salt-compatible crystallization additives

  • Structural analysis considerations:

    • NMR studies require salt-tolerant probes

    • Cryo-EM sample preparation must account for high salt content

    • Computational modeling must incorporate halophilic-specific force fields

What approaches are recommended for investigating protein-protein interactions involving CrcB homolog 1?

Investigation of CrcB homolog 1 interactions requires specialized techniques compatible with high salt environments:

  • Pull-down assays:

    • Use His-tagged CrcB homolog 1 as bait

    • Maintain high salt concentrations in all buffers

    • Verify interactions with orthogonal methods

  • Co-immunoprecipitation:

    • Custom antibodies must be raised against purified CrcB homolog 1

    • Control experiments should account for salt-dependent association changes

    • Include detergent controls for membrane-associated interactions

  • Yeast two-hybrid adaptations:

    • Standard Y2H systems are incompatible with halophilic proteins

    • Consider split-protein complementation assays in native-like hosts

    • Develop H. volcanii-based two-hybrid systems for more reliable results

  • Crosslinking mass spectrometry:

    • In vivo crosslinking prior to cell lysis

    • Salt-compatible MS sample preparation

    • Data analysis accounting for halophilic protein sequence peculiarities

What strategies exist for functional genomics studies of CrcB homolog 1 in Halobacterium salinarum?

For comprehensive functional characterization:

  • Gene knockout approaches:

    • The Halobacterium genome contains multiple DNA replication origins

    • Target gene deletion using established archaeal genetic tools

    • Complement with wild-type and mutant variants to verify phenotypes

  • Promoter analysis:

    • Identify regulatory elements controlling crcB1 expression

    • Consider the complex transcription machinery of Halobacterium that resembles eukaryotic systems

    • Analyze binding sites for archaeal transcription factors

  • Reporter systems:

    • Develop halophile-compatible reporters for in vivo studies

    • Beta-galactosidase assays adapted to high salt

    • Fluorescent protein variants stable in halophilic conditions

How does CrcB homolog 1 from Halobacterium salinarum compare to homologs in other extremophiles?

When conducting comparative analyses:

  • Sequence conservation patterns:

    • Align with homologs from other halophiles, thermophiles, and mesophilic organisms

    • Identify conserved domains and halophile-specific variations

    • Use the 2,630 predicted proteins from the Halobacterium genome as a starting point

  • Structural homology modeling:

    • Base models on known structures of CrcB homologs where available

    • Pay special attention to regions with high acidic residue content

    • Validate models with experimental data when possible

  • Domain architecture analysis:

    • Compare domain organization across different species

    • Identify unique features in the Halobacterium salinarum variant

    • Correlate structural features with known environmental adaptations

What bioinformatic tools are most appropriate for analyzing CrcB homolog 1?

For computational analysis:

  • Specialized sequence analysis:

    • Use alignment tools optimized for halophilic proteins

    • Account for atypical amino acid compositions when calculating hydrophobicity

    • Consider codon usage bias in Halobacterium (67.9% GC content in main chromosome)

  • Structure prediction:

    • Employ tools that account for high salt environments

    • Validate predictions with experimental structural data

    • Use molecular dynamics simulations with appropriate force fields

  • Genome context analysis:

    • Examine neighboring genes for functional relationships

    • Consider the three replicons (main chromosome, pNRC100, pNRC200) when analyzing genomic location

    • Investigate potential operonic structures

What are the most common pitfalls when expressing and purifying CrcB homolog 1?

ChallengePotential CauseRecommended Solution
Low expression yieldImproper salt concentrationMaintain 4.28 M NaCl in growth medium
Suboptimal growth phaseHarvest at stationary phase (OD₆₀₀ = 1.0–1.6)
Copy number issuesOptimize vector choice and promoter strength
Protein inactivityDenaturation during purificationKeep high salt concentration in all buffers
Improper metal cofactorsSupplement with physiological ions
Proteolytic degradationAdd protease inhibitors during extraction
AggregationRapid dilution of saltUse step-down salt gradient for any dilution steps
Improper pHMaintain pH 7.4 for optimal stability
Temperature fluctuationKeep samples at 4°C throughout purification

How can researchers troubleshoot expression issues specific to Halobacterium proteins?

For expression troubleshooting:

  • Vector design considerations:

    • Ensure promoter compatibility with H. volcanii machinery

    • Verify codon optimization if synthetic genes are used

    • Check for proper inclusion of His-tag or other fusion tags

  • Cell lysis optimization:

    • Test different lysis methods for yield and activity retention

    • Ensure maintenance of high salt conditions during lysis

    • Monitor protein stability throughout the process

  • Expression monitoring:

    • Use Western blotting to track protein expression over time

    • Optimize induction conditions if using inducible promoters

    • Compare cytoplasmic and membrane fractions to determine localization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.