Recombinant Halobacterium salinarum Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Description

Introduction to CrcB Homolog 2 in Halobacterium salinarum

The CrcB (chloride resistance protein B) family is conserved across archaea and bacteria, often linked to stress responses such as fluoride resistance and osmotic regulation. While the provided search results do not explicitly mention "Recombinant Halobacterium salinarum Protein CrcB Homolog 2 (crcB2)," insights can be inferred from related studies on H. salinarum's stress adaptation mechanisms and recombinant protein production methodologies.

Functional Context of CrcB Homologs

CrcB proteins are membrane-associated and implicated in ion homeostasis. In H. salinarum, homologs of stress-response proteins are critical for survival in hypersaline environments. For example:

  • Ion Transport Systems: H. salinarum employs potassium transporters (kdpABC, trkAH) and sodium efflux systems (nhaC) to maintain osmotic balance .

  • Acidic Proteome Adaptation: The organism’s proteins are highly acidic (average pI ~5), enabling solubility and function in high-salt conditions .

Although crcB2 is not directly discussed in the provided sources, its homologs likely participate in similar ion regulation or stress-response pathways.

Recombinant Protein Production in H. salinarum

H. salinarum is a model for studying extremophile biology, with established tools for recombinant protein analysis:

  • Site-Directed Mutagenesis: Used to investigate functional residues in retinal proteins like bacteriorhodopsin .

  • Proteomic Workflows: The H. salinarum PeptideAtlas catalogs 1,646 detected proteins (63% of the predicted proteome), including transporters and stress-response factors .

Table 1: Key Methods for Recombinant Protein Studies in H. salinarum

MethodApplication in H. salinarumExample Study
Site-directed mutagenesisMapping functional residues in pumps/receptorsBacteriorhodopsin studies
Transcriptomic profilingIdentifying stress-regulated genesSalinity/temperature responses
Proteomic surveysDetecting 1,646 proteins via MS/MSPeptideAtlas

Hypothetical Role of crcB2 Based on Genomic and Proteomic Data

While crcB2 is not explicitly cited, systems-level analyses of H. salinarum provide clues:

  • Post-Transcriptional Regulation: Over 1,394 genes are regulated post-transcriptionally via mechanisms like antisense RNAs and RNases .

  • Stress-Responsive Pathways: Temperature shifts alter lipid metabolism and gas vesicle production , while low oxygen induces retinal biosynthesis .

A crcB2 homolog could plausibly interact with these networks, given its putative role in ion resistance.

Research Gaps and Future Directions

The absence of direct references to crcB2 in the provided materials highlights the need for targeted studies. Recommended approaches include:

  1. Heterologous Expression: Cloning crcB2 into H. salinarum vectors (e.g., pMPK424 ) for functional assays.

  2. CRISPR Interference: To knockout crcB2 and assess phenotypic changes under stress.

  3. Structural Analysis: Cryo-EM or X-ray crystallography to resolve crcB2’s architecture.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB2; VNG_1921H; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)
Target Names
crcB2
Target Protein Sequence
MGIPLRIDARSTALVAVGGAVGAVLRYTVAQAIAGPLGTLAANAAGSLALGALAYEAAAT DSVLSADAHTLLGTGCLSAFTTYSTFAVQTAGLAPRWMAANVATTYALGFAGVLVGRAIA ATARGDRR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB homolog 2 in Halobacterium salinarum?

The CrcB homolog 2 (crcB2) protein in Halobacterium salinarum belongs to a family of membrane proteins that function as fluoride ion channels. These proteins are involved in fluoride resistance mechanisms that allow microorganisms to survive in environments containing fluoride. The crcB genes encode for fluoride channels that export fluoride ions from the cytoplasm to the extracellular environment, thereby maintaining low intracellular fluoride concentrations and protecting sensitive intracellular enzymes from fluoride toxicity . In hypersaline-adapted archaea like Halobacterium salinarum, these ion channels play a crucial role in maintaining ion homeostasis, which is essential for survival in extreme environments .

How does CrcB2 differ from CrcB1 in terms of function and expression?

While both CrcB1 and CrcB2 are involved in fluoride resistance, research indicates potential functional and regulatory differences between these homologs. In studies of oral streptococci, both crcB1 and crcB2 were found to be crucial for fluoride resistance in Group III species like Streptococcus sanguinis . The co-existence of both homologs suggests complementary or specialized roles.

In Halobacterium salinarum, the expression of crcB genes may be regulated in response to environmental conditions such as salt concentration or the presence of fluoride ions. Unlike some bacterial species where either CrcB or EriC (another type of fluoride channel) predominates, Halobacterium salinarum appears to utilize CrcB-type channels for fluoride resistance . The expression of crcB2 may be linked to specific environmental adaptations that allow Halobacterium salinarum to thrive in its unique hypersaline habitat.

What are the recommended storage conditions for recombinant CrcB2 protein?

For optimal stability and activity maintenance of recombinant Halobacterium salinarum CrcB homolog 2 protein, the following storage conditions are recommended:

Storage PeriodRecommended ConditionsAdditional Notes
Short-term4°C for up to one weekAvoid repeated freeze-thaw cycles
Long-term-20°C or -80°CStore in Tris-based buffer with 50% glycerol

The protein should be stored in small working aliquots to prevent degradation from repeated freezing and thawing. The storage buffer is typically a Tris-based buffer containing 50% glycerol that is optimized for this specific protein . When handling the protein, maintain sterile conditions and use appropriate protective equipment to prevent contamination.

What experimental approaches are most effective for studying CrcB2 function in Halobacterium salinarum?

To investigate the function of CrcB2 in Halobacterium salinarum, researchers should consider a multi-faceted approach combining genetic, biochemical, and physiological methodologies:

  • Gene Deletion and Complementation Studies: Creating knockout mutants of crcB2 allows assessment of its contribution to fluoride resistance. For example, studies in streptococci have used this approach to demonstrate fluoride sensitivity in crcB deletion mutants. Complementation experiments, where the gene is reintroduced into knockout strains, can confirm phenotypic restoration .

  • Fluoride Transport Assays: Measuring the rate of fluoride ion transport across membranes in wild-type versus crcB2 mutant strains using fluoride-selective electrodes or fluorescent indicators provides direct evidence of channel function.

  • Protein Localization: Techniques such as immunofluorescence microscopy using antibodies against tagged CrcB2 proteins or GFP-fusion proteins can determine subcellular localization.

  • Electrophysiological Studies: Patch-clamp techniques applied to membrane vesicles containing reconstituted CrcB2 can provide insights into channel kinetics and ion selectivity.

  • Structural Studies: X-ray crystallography or cryo-electron microscopy of purified CrcB2 can elucidate the three-dimensional structure, providing insights into the mechanism of fluoride transport.

These approaches can be complemented with computational modeling and comparative genomics to place findings in an evolutionary context .

How do environmental factors affect the expression and activity of CrcB2 in extremophiles?

The expression and activity of CrcB2 in extremophiles like Halobacterium salinarum are influenced by multiple environmental factors:

Environmental FactorEffect on CrcB2Experimental Evidence
Fluoride concentrationUpregulation of expressionGene expression analysis in the presence of various fluoride concentrations
Salt concentrationModulation of channel activityFunctional assays at different salt concentrations
pHAltered transport kineticsFluoride transport measurements at varying pH
TemperatureChanges in protein stabilityThermal stability assays of purified protein

In hypersaline environments, where Halobacterium salinarum naturally occurs, high salt concentrations may affect membrane fluidity and protein conformation, potentially influencing CrcB2 activity. Research in similar archaeal systems suggests that extremophiles have evolved specific regulatory mechanisms to control ion channel expression in response to environmental stressors .

Gene expression studies similar to those conducted for TrmB in Halobacterium salinarum could be applied to understand how crcB2 transcription responds to environmental changes. Such studies might employ techniques like qRT-PCR, RNA-seq, or ChIP-seq to identify regulatory elements and transcription factors controlling crcB2 expression .

What are the challenges in expressing and purifying functional recombinant CrcB2 for structural studies?

Expressing and purifying membrane proteins like CrcB2 presents several significant challenges:

  • Membrane Protein Solubility: CrcB2 is a membrane protein with multiple transmembrane domains, making it inherently hydrophobic and difficult to maintain in solution without appropriate detergents or lipid environments.

  • Expression System Selection: The choice between prokaryotic (E. coli) and eukaryotic expression systems affects protein folding and post-translational modifications. For archaeal proteins like CrcB2, heterologous expression may result in misfolding due to differences in membrane composition and protein processing machinery.

  • Protein Stability: Maintaining the native conformation during purification requires careful optimization of buffer conditions, including pH, salt concentration, and stabilizing agents.

  • Functional Verification: Confirming that purified CrcB2 retains its fluoride transport activity is essential but challenging, often requiring reconstitution into liposomes or nanodiscs for functional assays.

To address these challenges, researchers often employ strategies such as fusion tags (His-tag, MBP, etc.) to enhance solubility, specialized detergents for membrane protein extraction, and gentle purification techniques to preserve protein structure and function . Verification of proper folding can be performed using circular dichroism spectroscopy, while function can be assessed through reconstitution experiments followed by ion transport assays.

How does the fluoride resistance mechanism of CrcB2 in Halobacterium salinarum compare to other microorganisms?

The fluoride resistance mechanism mediated by CrcB2 in Halobacterium salinarum shares fundamental similarities with other microorganisms but also exhibits distinct characteristics:

  • Comparison with Bacterial Systems:

    • In oral streptococci, species are categorized into three groups based on the distribution of fluoride resistance genes. While Group I (e.g., Streptococcus mutans) relies primarily on EriC1, and Group II depends on EriC1 but not EriC2, Group III species (e.g., Streptococcus sanguinis) utilize both CrcB1 and CrcB2 for fluoride resistance .

    • Unlike some bacteria where CrcB and EriC channels show complementation when transferred between species, the co-existence of different F- channels did not produce additive effects on fluoride resistance in oral streptococci .

  • Archaeal Adaptations:

    • Halobacterium salinarum, as an extremophile, has likely evolved specialized adaptations in its CrcB2 structure and regulation to function optimally in hypersaline environments.

    • The genomic context of crcB2 in Halobacterium salinarum may differ from that in bacteria, potentially indicating integration with different metabolic or stress response pathways .

  • Evolutionary Considerations:

    • Sequence analysis and phylogenetic studies suggest that CrcB proteins are ancient and conserved across diverse prokaryotic lineages, indicating their fundamental importance in fluoride detoxification.

This comparative understanding provides insights into the evolutionary adaptation of ion transport mechanisms across different domains of life and environmental niches .

What are the optimal conditions for heterologous expression of Halobacterium salinarum CrcB2?

Based on experimental practices with similar archaeal membrane proteins, the following conditions are recommended for heterologous expression of Halobacterium salinarum CrcB2:

Expression SystemVector TypeInduction ConditionsSpecial Considerations
E. coli C41(DE3) or C43(DE3)pET or pBAD seriesIPTG 0.1-0.5 mM, 18-25°C, 16-24 hoursLow temperature induction to facilitate proper folding
Haloferax volcaniipTA963 or similarTryptophan depletionNative-like high salt environment
Cell-free systemCustomNASupplementation with archaeal lipids

When expressing halophilic archaeal proteins like CrcB2, it's critical to consider the natural high-salt environment of Halobacterium salinarum. Expression in E. coli often requires extensive optimization and may benefit from co-expression of archaeal chaperones to assist proper folding . Alternatively, expression in the archaeal host Haloferax volcanii can provide a more native-like environment for protein production.

For membrane proteins like CrcB2, fusion tags such as maltose-binding protein (MBP) or mistic can improve membrane targeting and extraction efficiency. The expression construct should be designed with appropriate affinity tags (e.g., His-tag) positioned to minimize interference with protein folding and function .

How can researchers assess the fluoride transport activity of purified CrcB2 protein?

To assess the fluoride transport activity of purified CrcB2 protein, researchers can employ several complementary approaches:

  • Liposome-Based Fluoride Transport Assays:

    • Reconstitute purified CrcB2 into liposomes composed of E. coli lipids or synthetic lipid mixtures

    • Load liposomes with a fluoride-sensitive fluorescent dye (e.g., PBFI modified for F- detection)

    • Monitor fluorescence changes upon addition of fluoride to the external medium

    • Calculate transport rates under varying conditions (pH, salt concentration, temperature)

  • Electrophysiological Measurements:

    • Incorporate CrcB2 into planar lipid bilayers or patch-clamp compatible membranes

    • Measure ion currents in response to fluoride gradients using electrophysiological techniques

    • Determine channel conductance, selectivity, and gating properties

  • Fluoride Electrode-Based Assays:

    • Use fluoride-selective electrodes to directly measure changes in fluoride concentration

    • Monitor fluoride efflux from proteoliposomes pre-loaded with fluoride

    • Compare transport rates between CrcB2-containing vesicles and control vesicles

  • Cellular Systems:

    • Express CrcB2 in crcB-deficient bacterial strains

    • Assess growth in the presence of varying fluoride concentrations

    • Measure intracellular fluoride accumulation using fluoride-sensitive probes

These approaches can be used individually or in combination to thoroughly characterize the transport properties of CrcB2 .

What genetic manipulation techniques are available for studying CrcB2 function in Halobacterium salinarum?

Several genetic manipulation techniques have been adapted for use in Halobacterium salinarum to study gene function, including crcB2:

  • Gene Knockout Strategies:

    • Homologous recombination-based methods using suicide vectors

    • Counter-selectable markers (e.g., pyrF) and two-stage selection/counterselection processes

    • CRISPR-Cas9 adapted for high-salt environments

  • Conditional Expression Systems:

    • Inducible promoters responsive to tryptophan (trpA), bacteriorhodopsin (bop), or other regulated promoters

    • Riboswitch-based control of gene expression

  • Complementation and Site-Directed Mutagenesis:

    • Introduction of wild-type or mutated crcB2 to rescue knockout phenotypes

    • Creation of point mutations to study structure-function relationships

  • Reporter Gene Fusions:

    • Construction of transcriptional or translational fusions with reporters like GFP adapted for halophiles

    • Analysis of gene expression patterns under different conditions

  • Protein Tagging for Localization and Interaction Studies:

    • Epitope tags (HA, FLAG) for immunodetection

    • Fluorescent protein fusions optimized for halophilic environments

The spheroplasting transformation method can be used to introduce DNA into Halobacterium salinarum, followed by selection on appropriate media lacking uracil (for pyrF-based systems) and counterselection using 5-fluoroorotic acid (5-FOA) . These approaches allow comprehensive investigation of CrcB2 function within its native cellular context.

How might understanding CrcB2 function contribute to biotechnological applications?

Research on Halobacterium salinarum CrcB2 has several potential biotechnological applications:

  • Bioremediation of Fluoride-Contaminated Environments:

    • Engineered microorganisms expressing CrcB2 could be developed to remove fluoride from contaminated water sources

    • Understanding the mechanism of fluoride transport could lead to biomimetic materials for selective fluoride extraction

  • Extremozyme Development:

    • CrcB2, as a protein adapted to function in extreme conditions, may inspire the design of enzymes and channels with enhanced stability for industrial processes

    • Insights into salt adaptation could lead to protein engineering strategies for improved function in non-aqueous solvents

  • Biosensor Technology:

    • CrcB2-based fluoride biosensors could be developed for environmental monitoring

    • Integration with electrical or optical detection systems for real-time monitoring of fluoride levels

  • Antimicrobial Strategy Development:

    • Knowledge of fluoride resistance mechanisms could inform the development of new antimicrobial compounds targeting CrcB function in pathogenic organisms

    • Combination therapies exploiting fluoride sensitivity in organisms lacking robust CrcB systems

  • Synthetic Biology Applications:

    • CrcB2 could be incorporated into synthetic cells or minimal genomes as part of ion homeostasis modules

    • Engineering of halophilic expression systems for biotechnological production of valuable proteins

These applications represent the translation of fundamental research on CrcB2 into practical technologies addressing environmental, medical, and industrial challenges .

What are the current gaps in our understanding of CrcB2 structure-function relationships?

Despite advances in understanding CrcB proteins, several critical knowledge gaps remain regarding CrcB2 structure-function relationships:

  • High-Resolution Structure: No high-resolution crystal or cryo-EM structure of Halobacterium salinarum CrcB2 is currently available, limiting our understanding of its precise channel architecture and ion selectivity mechanism.

  • Ion Selectivity Determinants: The specific amino acid residues and structural features that confer selectivity for fluoride ions over other anions remain incompletely characterized.

  • Oligomerization State: While CrcB proteins are predicted to function as dimers, the exact oligomerization state of Halobacterium salinarum CrcB2 in the native membrane environment and its impact on function requires further investigation.

  • Gating Mechanism: The molecular details of how CrcB2 channels open and close in response to fluoride concentrations or other signals are not fully understood.

  • Interactions with Other Cellular Components: Potential protein-protein interactions or lipid dependencies that might modulate CrcB2 function in vivo remain largely unexplored.

  • Evolutionary Adaptation: The specific adaptations that allow CrcB2 to function in the hypersaline environment of Halobacterium salinarum compared to homologs from non-extremophilic organisms are not well defined.

Addressing these knowledge gaps would significantly advance our understanding of fluoride transport mechanisms and provide insights for protein engineering and biotechnological applications .

How does the genomic context of crcB2 in Halobacterium salinarum provide insights into its regulation?

The genomic context of crcB2 in Halobacterium salinarum can provide valuable insights into its regulation and functional integration within cellular pathways:

  • Operon Structure and Co-regulated Genes:

    • Analysis of genes flanking crcB2 may reveal whether it exists as part of an operon with functionally related genes

    • Co-expressed genes could indicate participation in specific stress responses or metabolic pathways

  • Regulatory Elements:

    • Promoter analysis could identify binding sites for transcription factors such as TrmB family proteins, which are known to regulate various metabolic pathways in Halobacterium salinarum

    • The presence of regulatory RNA structures (e.g., riboswitches) might indicate post-transcriptional regulation in response to fluoride or other signals

  • Comparative Genomics:

    • Comparison with the genomic context of crcB genes across archaea and bacteria can reveal conserved regulatory patterns

    • Synteny analysis may identify functionally linked genes that have been maintained through evolution

  • Transcriptomic Evidence:

    • RNA-seq data under various stress conditions can reveal patterns of crcB2 expression

    • Correlation with other stress-responsive genes provides clues to regulatory networks

  • Chromatin Immunoprecipitation Sequencing (ChIP-seq):

    • Identifying transcription factors that bind to the crcB2 promoter region using techniques similar to those employed for studying TrmB binding sites in Halobacterium salinarum

Understanding the genomic context and regulation of crcB2 would provide a more comprehensive picture of how Halobacterium salinarum integrates fluoride resistance mechanisms within its broader cellular physiology and stress response systems .

What are the key considerations for researchers beginning work with Halobacterium salinarum CrcB2?

Researchers embarking on studies of Halobacterium salinarum CrcB2 should consider the following key points:

  • Specialized Growth Conditions: Halobacterium salinarum requires high salt concentrations (typically 3-5M NaCl) for growth, necessitating specialized media and laboratory equipment resistant to salt corrosion.

  • Protein Handling Challenges: As a membrane protein from an extremophile, CrcB2 requires careful optimization of expression, purification, and storage conditions to maintain native structure and function.

  • Genetic System Limitations: While genetic tools exist for Halobacterium salinarum, they are less developed than those for model organisms like E. coli, potentially requiring method optimization.

  • Interdisciplinary Approach: Comprehensive study of CrcB2 benefits from combining structural biology, biochemistry, genetics, and physiology approaches to address different aspects of its function.

  • Comparative Analysis: Interpreting results in the context of what is known about other CrcB proteins, such as those in oral streptococci where both crcB1 and crcB2 contribute to fluoride resistance .

  • Technical Considerations: Special attention to experimental design is needed for functional assays in high salt environments, as these conditions may affect the behavior of fluorescent dyes, electrode performance, and other analytical tools.

By addressing these considerations proactively, researchers can design more effective experiments and avoid common pitfalls associated with studying proteins from extremophilic organisms .

How has our understanding of CrcB proteins evolved through comparative studies across different species?

Our understanding of CrcB proteins has evolved significantly through comparative studies across diverse species, revealing important insights about their evolution, function, and distribution:

  • Evolutionary Conservation: CrcB proteins represent an ancient and conserved family of membrane proteins present across bacteria and archaea, suggesting their fundamental importance in cellular physiology.

  • Functional Diversification: Comparative studies have revealed that while the primary function of CrcB proteins is fluoride export, their specific roles and importance vary across species:

    • In oral streptococci, different species rely on different combinations of EriC and CrcB channels for fluoride resistance

    • Some species contain multiple CrcB homologs (CrcB1 and CrcB2) with potentially specialized functions

  • Structural Insights: Sequence comparisons across diverse CrcB proteins have identified conserved residues likely critical for channel function, guiding mutagenesis studies to understand structure-function relationships.

  • Environmental Adaptation: CrcB proteins from extremophiles like Halobacterium salinarum show adaptations that likely enable function in challenging environments, providing insights into protein stability and ion transport under extreme conditions.

  • Regulatory Diversity: The regulation of crcB genes varies across species, with evidence suggesting integration into different stress response networks and metabolic pathways .

These comparative studies have transformed our view of CrcB proteins from simple transporters to sophisticated components of cellular homeostasis systems with adaptation to diverse ecological niches and physiological contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.